BLASTX nr result
ID: Rehmannia29_contig00021403
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00021403 (600 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN04199.1| Serine/threonine protein kinase [Handroanthus imp... 66 5e-09 ref|XP_020554446.1| G-type lectin S-receptor-like serine/threoni... 62 1e-07 ref|XP_020554444.1| G-type lectin S-receptor-like serine/threoni... 62 1e-07 ref|XP_020554439.1| G-type lectin S-receptor-like serine/threoni... 62 1e-07 ref|XP_020554438.1| G-type lectin S-receptor-like serine/threoni... 62 1e-07 gb|PON53022.1| Serine/threonine protein kinase, partial [Paraspo... 60 3e-07 gb|EYU33567.1| hypothetical protein MIMGU_mgv1a003819mg [Erythra... 60 3e-07 gb|PIN01254.1| Non-specific serine/threonine protein kinase [Han... 60 3e-07 ref|XP_012841701.1| PREDICTED: G-type lectin S-receptor-like ser... 60 3e-07 ref|XP_020554447.1| G-type lectin S-receptor-like serine/threoni... 59 8e-07 ref|XP_018674030.1| PREDICTED: G-type lectin S-receptor-like ser... 59 9e-07 ref|XP_020554440.1| G-type lectin S-receptor-like serine/threoni... 59 9e-07 gb|PON81475.1| hypothetical protein TorRG33x02_227440, partial [... 59 9e-07 ref|XP_020554445.1| G-type lectin S-receptor-like serine/threoni... 59 1e-06 gb|EYU29566.1| hypothetical protein MIMGU_mgv1a024848mg [Erythra... 58 3e-06 ref|XP_024021182.1| G-type lectin S-receptor-like serine/threoni... 57 5e-06 gb|PIN09001.1| Serine/threonine protein kinase [Handroanthus imp... 57 5e-06 gb|PON43781.1| S-receptor-like serine/threonine-protein kinase [... 57 7e-06 gb|PON81476.1| S-receptor-like serine/threonine-protein kinase [... 56 9e-06 gb|PON86664.1| S-receptor-like serine/threonine-protein kinase [... 56 1e-05 >gb|PIN04199.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 810 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 479 RNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 RN KD+ELPLFKLATI+ A NNFS EN IGE GFGPVH Sbjct: 470 RNNKDIELPLFKLATIVAATNNFSNENFIGEGGFGPVH 507 >ref|XP_020554446.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X10 [Sesamum indicum] Length = 759 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -2 Query: 482 KRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVHIVTSKTRFGRIRRFDRAKGK 306 K+NE D+ELPLFK TIL A NNFSKEN+IGE GFGPV+ ++R R G+ Sbjct: 481 KKNE-DLELPLFKWTTILAATNNFSKENVIGEGGFGPVYRGNFSAEEIAVKRLSRTSGQ 538 >ref|XP_020554444.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X8 [Sesamum indicum] Length = 818 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -2 Query: 482 KRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVHIVTSKTRFGRIRRFDRAKGK 306 K+NE D+ELPLFK TIL A NNFSKEN+IGE GFGPV+ ++R R G+ Sbjct: 479 KKNE-DLELPLFKWTTILAATNNFSKENVIGEGGFGPVYRGNFSAEEIAVKRLSRTSGQ 536 >ref|XP_020554439.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X4 [Sesamum indicum] Length = 819 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -2 Query: 482 KRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVHIVTSKTRFGRIRRFDRAKGK 306 K+NE D+ELPLFK TIL A NNFSKEN+IGE GFGPV+ ++R R G+ Sbjct: 480 KKNE-DLELPLFKWTTILAATNNFSKENVIGEGGFGPVYRGNFSAEEIAVKRLSRTSGQ 537 >ref|XP_020554438.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X3 [Sesamum indicum] Length = 820 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -2 Query: 482 KRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVHIVTSKTRFGRIRRFDRAKGK 306 K+NE D+ELPLFK TIL A NNFSKEN+IGE GFGPV+ ++R R G+ Sbjct: 481 KKNE-DLELPLFKWTTILAATNNFSKENVIGEGGFGPVYRGNFSAEEIAVKRLSRTSGQ 538 >gb|PON53022.1| Serine/threonine protein kinase, partial [Parasponia andersonii] Length = 388 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/55 (54%), Positives = 36/55 (65%) Frame = -2 Query: 530 WKARTRMEG*HSLTSAKRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 WK+RTR +G KR E+D+ELPLF TI T NNFS N+IG GFGPV+ Sbjct: 36 WKSRTRTKG-------KREEEDLELPLFDFTTIATTTNNFSPSNMIGAGGFGPVY 83 >gb|EYU33567.1| hypothetical protein MIMGU_mgv1a003819mg [Erythranthe guttata] Length = 562 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/42 (66%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -2 Query: 488 SAKRNE-KDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 +AK+N+ D+ELP+FKLATIL A NNF+KEN+IG+ GFGPV+ Sbjct: 218 AAKKNDGNDLELPIFKLATILAATNNFAKENVIGKGGFGPVY 259 >gb|PIN01254.1| Non-specific serine/threonine protein kinase [Handroanthus impetiginosus] Length = 614 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 479 RNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 RN +D+ELPLFKLATI+ NNFSKEN+IG GFGPV+ Sbjct: 470 RNNEDIELPLFKLATIVATTNNFSKENLIGGGGFGPVY 507 >ref|XP_012841701.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X1 [Erythranthe guttata] Length = 818 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/42 (66%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -2 Query: 488 SAKRNE-KDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 +AK+N+ D+ELP+FKLATIL A NNF+KEN+IG+ GFGPV+ Sbjct: 474 AAKKNDGNDLELPIFKLATILAATNNFAKENVIGKGGFGPVY 515 >ref|XP_020554447.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X11 [Sesamum indicum] Length = 758 Score = 59.3 bits (142), Expect = 8e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 488 SAKRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 +A++ +D+ELP+FK TIL A NNFSKEN+IGE GFGPV+ Sbjct: 476 AAQKKNEDLELPVFKWTTILAATNNFSKENVIGEGGFGPVY 516 >ref|XP_018674030.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Musa acuminata subsp. malaccensis] Length = 803 Score = 59.3 bits (142), Expect = 9e-07 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -2 Query: 527 KARTRMEG*HSLTSAKRNEKD-VELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 K R R +G +KR+E+D +ELPLF + TI TA N+FS ENIIGE GFGPV+ Sbjct: 453 KCRRRTQGKRKSFQSKRDEEDELELPLFDILTIRTATNDFSNENIIGEGGFGPVY 507 >ref|XP_020554440.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X5 [Sesamum indicum] Length = 819 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 488 SAKRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 +A++ +D+ELP+FK TIL A NNFSKEN+IGE GFGPV+ Sbjct: 476 AAQKKNEDLELPVFKWTTILAATNNFSKENVIGEGGFGPVY 516 >gb|PON81475.1| hypothetical protein TorRG33x02_227440, partial [Trema orientalis] Length = 388 Score = 58.9 bits (141), Expect = 9e-07 Identities = 29/55 (52%), Positives = 35/55 (63%) Frame = -2 Query: 530 WKARTRMEG*HSLTSAKRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 WK+RTR +G K E+D+ELPLF TI T NNFS N+IG GFGPV+ Sbjct: 36 WKSRTRTKG-------KSEEEDIELPLFDFTTIATTTNNFSPSNMIGAGGFGPVY 83 >ref|XP_020554445.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X9 [Sesamum indicum] Length = 818 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -2 Query: 485 AKRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 A++ +D+ELP+FK TIL A NNFSKEN+IGE GFGPV+ Sbjct: 476 AQKKNEDLELPVFKWTTILAATNNFSKENVIGEGGFGPVY 515 >gb|EYU29566.1| hypothetical protein MIMGU_mgv1a024848mg [Erythranthe guttata] Length = 739 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -2 Query: 482 KRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVHIV 360 K ++ D+ELP+FKL TI+ A NNFS ENIIGE GFGPV+ V Sbjct: 409 KNDDDDLELPIFKLVTIVAATNNFSIENIIGEGGFGPVYKV 449 >ref|XP_024021182.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Morus notabilis] Length = 813 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/53 (52%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -2 Query: 521 RTRMEG*HSLTSAKRN-EKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 RT+++G +S T+ K + E+D+ELPLF+L+TI+ A NNFS N +G+ GFGPV+ Sbjct: 462 RTKLKGKYSRTAKKGDQEEDLELPLFELSTIVNATNNFSWRNKLGQGGFGPVY 514 >gb|PIN09001.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 833 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 479 RNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 RN +D+ELP FK ATI+ A NNFS EN+IG+ GFGPV+ Sbjct: 493 RNNEDIELPSFKFATIVAATNNFSMENLIGKGGFGPVY 530 >gb|PON43781.1| S-receptor-like serine/threonine-protein kinase [Parasponia andersonii] Length = 813 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -2 Query: 530 WKARTRMEG*HSLTSAKRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 WK+R R+ G + +DVELPLF LATI A NNFS ++IGE GFGPV+ Sbjct: 463 WKSRKRVRG-------QSKNEDVELPLFDLATIAAATNNFSDTSMIGEGGFGPVY 510 >gb|PON81476.1| S-receptor-like serine/threonine-protein kinase [Trema orientalis] Length = 732 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = -2 Query: 530 WKARTRMEG*HSLTSAKRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 WK + R+ G K +KD+ELPLF LATI +A NF+ EN+IG GFGPV+ Sbjct: 469 WKFKNRVNG-------KVKDKDIELPLFDLATITSATKNFTPENMIGAGGFGPVY 516 >gb|PON86664.1| S-receptor-like serine/threonine-protein kinase [Trema orientalis] Length = 813 Score = 56.2 bits (134), Expect = 1e-05 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = -2 Query: 530 WKARTRMEG*HSLTSAKRNEKDVELPLFKLATILTAWNNFSKENIIGERGFGPVH 366 WK+R R+ G + +D+ELPLF LATI A NNFS ++IGE GFGPV+ Sbjct: 463 WKSRKRVRG-------QSKNEDIELPLFDLATIAAATNNFSDTSMIGEGGFGPVY 510