BLASTX nr result
ID: Rehmannia29_contig00021365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00021365 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22779.1| hypothetical protein MIMGU_mgv1a001076mg [Erythra... 65 2e-09 ref|XP_012854925.1| PREDICTED: U3 small nucleolar RNA-associated... 65 2e-09 gb|EYU22778.1| hypothetical protein MIMGU_mgv1a001076mg [Erythra... 65 2e-09 ref|XP_012854924.1| PREDICTED: U3 small nucleolar RNA-associated... 65 2e-09 gb|PIN11413.1| hypothetical protein CDL12_15982 [Handroanthus im... 63 9e-09 ref|XP_011096198.1| U3 small nucleolar RNA-associated protein 14... 62 2e-08 >gb|EYU22779.1| hypothetical protein MIMGU_mgv1a001076mg [Erythranthe guttata] Length = 894 Score = 65.1 bits (157), Expect = 2e-09 Identities = 38/59 (64%), Positives = 40/59 (67%) Frame = +1 Query: 1 VGALNRPEVVKRAGVIIKPIAYEDMSVRERAEIRKRSXXXXXXXXXXXNRSMK*LTANV 177 VGALNRPEVVKRAG+ IKPI YEDMSVRER E RKR +RSMK TA V Sbjct: 837 VGALNRPEVVKRAGLNIKPIQYEDMSVRERVEARKRD-AQKQRNGKDKSRSMKKTTAKV 894 >ref|XP_012854925.1| PREDICTED: U3 small nucleolar RNA-associated protein 14 homolog A isoform X2 [Erythranthe guttata] Length = 895 Score = 65.1 bits (157), Expect = 2e-09 Identities = 38/59 (64%), Positives = 40/59 (67%) Frame = +1 Query: 1 VGALNRPEVVKRAGVIIKPIAYEDMSVRERAEIRKRSXXXXXXXXXXXNRSMK*LTANV 177 VGALNRPEVVKRAG+ IKPI YEDMSVRER E RKR +RSMK TA V Sbjct: 838 VGALNRPEVVKRAGLNIKPIQYEDMSVRERVEARKRD-AQKQRNGKDKSRSMKKTTAKV 895 >gb|EYU22778.1| hypothetical protein MIMGU_mgv1a001076mg [Erythranthe guttata] Length = 895 Score = 65.1 bits (157), Expect = 2e-09 Identities = 38/59 (64%), Positives = 40/59 (67%) Frame = +1 Query: 1 VGALNRPEVVKRAGVIIKPIAYEDMSVRERAEIRKRSXXXXXXXXXXXNRSMK*LTANV 177 VGALNRPEVVKRAG+ IKPI YEDMSVRER E RKR +RSMK TA V Sbjct: 838 VGALNRPEVVKRAGLNIKPIQYEDMSVRERVEARKRD-AQKQRNGKDKSRSMKKTTAKV 895 >ref|XP_012854924.1| PREDICTED: U3 small nucleolar RNA-associated protein 14 homolog A isoform X1 [Erythranthe guttata] Length = 896 Score = 65.1 bits (157), Expect = 2e-09 Identities = 38/59 (64%), Positives = 40/59 (67%) Frame = +1 Query: 1 VGALNRPEVVKRAGVIIKPIAYEDMSVRERAEIRKRSXXXXXXXXXXXNRSMK*LTANV 177 VGALNRPEVVKRAG+ IKPI YEDMSVRER E RKR +RSMK TA V Sbjct: 839 VGALNRPEVVKRAGLNIKPIQYEDMSVRERVEARKRD-AQKQRNGKDKSRSMKKTTAKV 896 >gb|PIN11413.1| hypothetical protein CDL12_15982 [Handroanthus impetiginosus] Length = 910 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1 VGALNRPEVVKRAGVIIKPIAYEDMSVRERAEIRKRS 111 +GALNRPEVVKRAGVIIKPI YEDMS+ ERAE RK + Sbjct: 853 IGALNRPEVVKRAGVIIKPIQYEDMSIHERAENRKHN 889 >ref|XP_011096198.1| U3 small nucleolar RNA-associated protein 14 homolog A [Sesamum indicum] Length = 903 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 VGALNRPEVVKRAGVIIKPIAYEDMSVRERAEIRKRS 111 +GALNRPEVVK+AGVIIKPI YEDM+VRERAE K + Sbjct: 846 IGALNRPEVVKKAGVIIKPIQYEDMNVRERAETHKHN 882