BLASTX nr result
ID: Rehmannia29_contig00020964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00020964 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096067.1| calcium-dependent protein kinase [Sesamum in... 99 5e-21 ref|XP_022876971.1| calcium-dependent protein kinase 21-like [Ol... 93 7e-21 gb|PIN08573.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 95 9e-20 ref|XP_011086186.1| calcium-dependent protein kinase [Sesamum in... 95 9e-20 gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja] 93 2e-19 ref|XP_022867973.1| calcium-dependent protein kinase 21-like [Ol... 92 3e-19 ref|XP_014622595.1| PREDICTED: calcium-dependent protein kinase ... 93 4e-19 ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase ... 93 6e-19 ref|XP_019262708.1| PREDICTED: calcium-dependent protein kinase ... 93 6e-19 ref|NP_001311569.1| calcium-dependent protein kinase 21-like [Ni... 93 6e-19 ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase ... 93 6e-19 gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja] 92 6e-19 ref|XP_020205678.1| calcium-dependent protein kinase 2-like [Caj... 92 1e-18 ref|XP_024156502.1| calcium-dependent protein kinase 2-like [Ros... 92 1e-18 ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase ... 92 1e-18 ref|XP_002518484.1| PREDICTED: calcium-dependent protein kinase ... 92 1e-18 ref|XP_022877975.1| calcium-dependent protein kinase-like isofor... 91 2e-18 ref|XP_022877974.1| calcium-dependent protein kinase-like isofor... 91 2e-18 ref|XP_022879977.1| calcium-dependent protein kinase 2-like [Ole... 85 3e-18 gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [... 89 3e-18 >ref|XP_011096067.1| calcium-dependent protein kinase [Sesamum indicum] Length = 541 Score = 98.6 bits (244), Expect = 5e-21 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF Sbjct: 495 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 541 >ref|XP_022876971.1| calcium-dependent protein kinase 21-like [Olea europaea var. sylvestris] Length = 165 Score = 92.8 bits (229), Expect = 7e-21 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFC MMRSGT QQ KLF Sbjct: 119 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCQMMRSGTTQQAKLF 165 >gb|PIN08573.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 536 Score = 95.1 bits (235), Expect = 9e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEIISEVDTDNDGRINY+EFCAMMRSGT QQVKLF Sbjct: 490 MKEYGMGDEATIKEIISEVDTDNDGRINYDEFCAMMRSGTTQQVKLF 536 >ref|XP_011086186.1| calcium-dependent protein kinase [Sesamum indicum] Length = 543 Score = 95.1 bits (235), Expect = 9e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEIISEVDTDNDGRINY+EFCAMMRSGTQQ VKLF Sbjct: 497 MKEYGMGDEATIKEIISEVDTDNDGRINYDEFCAMMRSGTQQPVKLF 543 >gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja] Length = 404 Score = 93.2 bits (230), Expect = 2e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 358 MKEYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 404 >ref|XP_022867973.1| calcium-dependent protein kinase 21-like [Olea europaea var. sylvestris] Length = 305 Score = 91.7 bits (226), Expect = 3e-19 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATI+EIISEVDTDNDGRINYEEFC MMRSGT QQ KLF Sbjct: 259 MKEYGMGDEATIREIISEVDTDNDGRINYEEFCEMMRSGTTQQAKLF 305 >ref|XP_014622595.1| PREDICTED: calcium-dependent protein kinase 33-like [Glycine max] gb|KRH14398.1| hypothetical protein GLYMA_14G023500 [Glycine max] Length = 539 Score = 93.2 bits (230), Expect = 4e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 493 MKEYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 539 >ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana tomentosiformis] ref|XP_016477399.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana tabacum] Length = 534 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KLF Sbjct: 488 MKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF 534 >ref|XP_019262708.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana attenuata] gb|OIT37620.1| calcium-dependent protein kinase 21 [Nicotiana attenuata] Length = 538 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KLF Sbjct: 492 MKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF 538 >ref|NP_001311569.1| calcium-dependent protein kinase 21-like [Nicotiana tabacum] gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] Length = 540 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KLF Sbjct: 494 MKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF 540 >ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana sylvestris] Length = 542 Score = 92.8 bits (229), Expect = 6e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KLF Sbjct: 496 MKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF 542 >gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja] Length = 391 Score = 92.0 bits (227), Expect = 6e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATI+EIISEVDTDNDGRINY+EFC MMRSGTQQQ KLF Sbjct: 345 MKEYGMGDEATIREIISEVDTDNDGRINYDEFCTMMRSGTQQQGKLF 391 >ref|XP_020205678.1| calcium-dependent protein kinase 2-like [Cajanus cajan] gb|KYP73408.1| Calcium-dependent protein kinase 9 [Cajanus cajan] Length = 529 Score = 92.0 bits (227), Expect = 1e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MK+YGMGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 483 MKDYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 529 >ref|XP_024156502.1| calcium-dependent protein kinase 2-like [Rosa chinensis] gb|PRQ31821.1| putative calcium/calmodulin-dependent protein kinase CAMK-CDPK family [Rosa chinensis] Length = 541 Score = 92.0 bits (227), Expect = 1e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATI++IISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 495 MKEYGMGDEATIRDIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 541 >ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria vesca subsp. vesca] Length = 541 Score = 92.0 bits (227), Expect = 1e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATI++IISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 495 MKEYGMGDEATIRDIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 541 >ref|XP_002518484.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] ref|XP_015574254.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] ref|XP_015574255.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] ref|XP_015574256.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 551 Score = 91.7 bits (226), Expect = 1e-18 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSG QQ KLF Sbjct: 505 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGIQQAEKLF 551 >ref|XP_022877975.1| calcium-dependent protein kinase-like isoform X2 [Olea europaea var. sylvestris] Length = 554 Score = 91.3 bits (225), Expect = 2e-18 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDE TIKEIISEVDTDNDGRINYEEFC MMRSGT QQ KLF Sbjct: 508 MKEYGMGDETTIKEIISEVDTDNDGRINYEEFCQMMRSGTTQQAKLF 554 >ref|XP_022877974.1| calcium-dependent protein kinase-like isoform X1 [Olea europaea var. sylvestris] Length = 559 Score = 91.3 bits (225), Expect = 2e-18 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGDE TIKEIISEVDTDNDGRINYEEFC MMRSGT QQ KLF Sbjct: 513 MKEYGMGDETTIKEIISEVDTDNDGRINYEEFCQMMRSGTTQQAKLF 559 >ref|XP_022879977.1| calcium-dependent protein kinase 2-like [Olea europaea var. sylvestris] Length = 125 Score = 85.1 bits (209), Expect = 3e-18 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MKEYGMGD ATIKEI+SEVD+DNDGRINYEEFC MMR+GTQQ +LF Sbjct: 79 MKEYGMGDPATIKEILSEVDSDNDGRINYEEFCTMMRTGTQQPDRLF 125 >gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis] gb|KDO62723.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis] Length = 293 Score = 89.0 bits (219), Expect = 3e-18 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +1 Query: 1 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 141 MK+YGMGD+ TIKEIISEVDTDNDGRINY+EFCAMMRSGTQ Q KLF Sbjct: 247 MKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKLF 293