BLASTX nr result
ID: Rehmannia29_contig00020924
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00020924 (902 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016700336.1| PREDICTED: mitochondrial succinate-fumarate ... 71 2e-10 ref|XP_012456322.1| PREDICTED: mitochondrial succinate-fumarate ... 71 2e-10 ref|XP_016676883.1| PREDICTED: mitochondrial succinate-fumarate ... 71 2e-10 ref|XP_019243235.1| PREDICTED: mitochondrial succinate-fumarate ... 70 4e-10 ref|XP_016494154.1| PREDICTED: mitochondrial succinate-fumarate ... 70 4e-10 ref|XP_009794600.1| PREDICTED: mitochondrial succinate-fumarate ... 70 4e-10 ref|XP_009623093.1| PREDICTED: mitochondrial succinate-fumarate ... 70 4e-10 gb|OMP02627.1| Endoplasmic reticulum-adenine nucleotide transpor... 70 5e-10 ref|XP_002322991.2| mitochondrial substrate carrier family prote... 69 2e-09 ref|XP_024018996.1| mitochondrial succinate-fumarate transporter... 69 2e-09 gb|PNS99189.1| hypothetical protein POPTR_016G119500v3 [Populus ... 69 2e-09 ref|XP_011095037.1| mitochondrial succinate-fumarate transporter... 68 2e-09 ref|XP_020190690.1| mitochondrial succinate-fumarate transporter... 68 2e-09 ref|XP_002263020.1| PREDICTED: mitochondrial succinate-fumarate ... 68 2e-09 ref|XP_020275059.1| mitochondrial succinate-fumarate transporter... 67 2e-09 gb|PIN19863.1| Mitochondrial tricarboxylate/dicarboxylate carrie... 68 2e-09 ref|XP_019188115.1| PREDICTED: mitochondrial succinate-fumarate ... 68 2e-09 ref|XP_018825923.1| PREDICTED: mitochondrial succinate-fumarate ... 68 2e-09 ref|XP_020578916.1| mitochondrial succinate-fumarate transporter... 68 2e-09 gb|PON92193.1| Mitochondrial substrate/solute carrier [Trema ori... 68 2e-09 >ref|XP_016700336.1| PREDICTED: mitochondrial succinate-fumarate transporter 1-like [Gossypium hirsutum] Length = 316 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCAH 731 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCAH Sbjct: 123 FGAGVLEALVIVTPFEVVKIRLQQQRGLSRELLKYKGPIHCAH 165 >ref|XP_012456322.1| PREDICTED: mitochondrial succinate-fumarate transporter 1 [Gossypium raimondii] gb|KJB73332.1| hypothetical protein B456_011G228400 [Gossypium raimondii] Length = 316 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCAH 731 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCAH Sbjct: 123 FGAGVLEALVIVTPFEVVKIRLQQQRGLSRELLKYKGPIHCAH 165 >ref|XP_016676883.1| PREDICTED: mitochondrial succinate-fumarate transporter 1-like [Gossypium hirsutum] ref|XP_017646861.1| PREDICTED: mitochondrial succinate-fumarate transporter 1-like [Gossypium arboreum] gb|KHG17573.1| Succinate/fumarate mitochondrial transporter [Gossypium arboreum] Length = 316 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCAH 731 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCAH Sbjct: 123 FGAGVLEALVIVTPFEVVKIRLQQQRGLSRELLKYKGPIHCAH 165 >ref|XP_019243235.1| PREDICTED: mitochondrial succinate-fumarate transporter 1 [Nicotiana attenuata] gb|OIT04506.1| mitochondrial succinate-fumarate transporter 1 [Nicotiana attenuata] Length = 309 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLSTELLKYKG HCA Sbjct: 116 FGAGVLEALVIVTPFEVVKIRLQQQRGLSTELLKYKGPIHCA 157 >ref|XP_016494154.1| PREDICTED: mitochondrial succinate-fumarate transporter 1-like [Nicotiana tabacum] Length = 309 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLSTELLKYKG HCA Sbjct: 116 FGAGVLEALVIVTPFEVVKIRLQQQRGLSTELLKYKGPIHCA 157 >ref|XP_009794600.1| PREDICTED: mitochondrial succinate-fumarate transporter 1 [Nicotiana sylvestris] Length = 309 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLSTELLKYKG HCA Sbjct: 116 FGAGVLEALVIVTPFEVVKIRLQQQRGLSTELLKYKGPIHCA 157 >ref|XP_009623093.1| PREDICTED: mitochondrial succinate-fumarate transporter 1 [Nicotiana tomentosiformis] ref|XP_016494545.1| PREDICTED: mitochondrial succinate-fumarate transporter 1-like [Nicotiana tabacum] Length = 309 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLSTELLKYKG HCA Sbjct: 116 FGAGVLEALVIVTPFEVVKIRLQQQRGLSTELLKYKGPIHCA 157 >gb|OMP02627.1| Endoplasmic reticulum-adenine nucleotide transporter [Corchorus capsularis] Length = 317 Score = 70.1 bits (170), Expect = 5e-10 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCAH 731 FG G+LEALVI+TPFEV+K RLQQQRGLS ELL+YKG HCAH Sbjct: 124 FGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLRYKGPIHCAH 166 >ref|XP_002322991.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 310 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/43 (76%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCAH 731 FG G+LEAL I+TPFEV+K RLQQQ+GLS ELLKYKG HCAH Sbjct: 117 FGAGVLEALAIVTPFEVVKIRLQQQKGLSPELLKYKGPIHCAH 159 >ref|XP_024018996.1| mitochondrial succinate-fumarate transporter 1 [Morus notabilis] Length = 316 Score = 68.6 bits (166), Expect = 2e-09 Identities = 39/61 (63%), Positives = 43/61 (70%), Gaps = 10/61 (16%) Frame = -2 Query: 886 ADKESQPSKTR--------FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HC 737 A K+SQ K FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HC Sbjct: 104 AFKDSQTGKVSNHGRVLSGFGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLKYKGPIHC 163 Query: 736 A 734 A Sbjct: 164 A 164 >gb|PNS99189.1| hypothetical protein POPTR_016G119500v3 [Populus trichocarpa] Length = 337 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/43 (76%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCAH 731 FG G+LEAL I+TPFEV+K RLQQQ+GLS ELLKYKG HCAH Sbjct: 117 FGAGVLEALAIVTPFEVVKIRLQQQKGLSPELLKYKGPIHCAH 159 >ref|XP_011095037.1| mitochondrial succinate-fumarate transporter 1 [Sesamum indicum] Length = 294 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCA Sbjct: 101 FGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLKYKGPIHCA 142 >ref|XP_020190690.1| mitochondrial succinate-fumarate transporter 1-like, partial [Aegilops tauschii subsp. tauschii] Length = 296 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/42 (78%), Positives = 38/42 (90%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQ+GLST+LLKYKG HCA Sbjct: 104 FGAGVLEALVIVTPFEVVKIRLQQQKGLSTDLLKYKGPIHCA 145 >ref|XP_002263020.1| PREDICTED: mitochondrial succinate-fumarate transporter 1 [Vitis vinifera] emb|CAN81800.1| hypothetical protein VITISV_020062 [Vitis vinifera] emb|CBI18247.3| unnamed protein product, partial [Vitis vinifera] Length = 306 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCA Sbjct: 113 FGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLKYKGPIHCA 154 >ref|XP_020275059.1| mitochondrial succinate-fumarate transporter 1 [Asparagus officinalis] Length = 222 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQ+GLS ELLKYKG HCA Sbjct: 29 FGAGVLEALVIVTPFEVVKIRLQQQKGLSPELLKYKGPVHCA 70 >gb|PIN19863.1| Mitochondrial tricarboxylate/dicarboxylate carrier protein [Handroanthus impetiginosus] Length = 309 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCA Sbjct: 116 FGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLKYKGPVHCA 157 >ref|XP_019188115.1| PREDICTED: mitochondrial succinate-fumarate transporter 1 [Ipomoea nil] Length = 310 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCA Sbjct: 117 FGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLKYKGPIHCA 158 >ref|XP_018825923.1| PREDICTED: mitochondrial succinate-fumarate transporter 1 [Juglans regia] Length = 312 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCA Sbjct: 119 FGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLKYKGPLHCA 160 >ref|XP_020578916.1| mitochondrial succinate-fumarate transporter 1 [Phalaenopsis equestris] Length = 313 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCA Sbjct: 124 FGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLKYKGPIHCA 165 >gb|PON92193.1| Mitochondrial substrate/solute carrier [Trema orientalis] Length = 315 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 853 FGVGMLEALVIITPFEVMKTRLQQQRGLSTELLKYKG--HCA 734 FG G+LEALVI+TPFEV+K RLQQQRGLS ELLKYKG HCA Sbjct: 122 FGAGVLEALVIVTPFEVVKIRLQQQRGLSPELLKYKGPIHCA 163