BLASTX nr result
ID: Rehmannia29_contig00020754
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00020754 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082108.1| uncharacterized protein LOC105164952 [Sesamu... 62 1e-08 gb|PIN05977.1| hypothetical protein CDL12_21477 [Handroanthus im... 54 6e-06 >ref|XP_011082108.1| uncharacterized protein LOC105164952 [Sesamum indicum] Length = 266 Score = 62.0 bits (149), Expect = 1e-08 Identities = 32/67 (47%), Positives = 46/67 (68%) Frame = -2 Query: 201 HLSSTQIELRPRLDKELQSISAAEESISGQIQPELTACHPAPPIMPPVVLTNDVTLQSSP 22 +L +IEL+P D+E+ S + E S+S Q+Q + T CHP PPI+PP+V N+V L+ S Sbjct: 169 NLKRMKIELQPIPDREIPSTT--EASMSDQLQQKTTPCHPIPPILPPLVSENNVKLEPS- 225 Query: 21 TSNACPE 1 +SN CPE Sbjct: 226 SSNGCPE 232 >gb|PIN05977.1| hypothetical protein CDL12_21477 [Handroanthus impetiginosus] Length = 258 Score = 54.3 bits (129), Expect = 6e-06 Identities = 34/67 (50%), Positives = 47/67 (70%) Frame = -2 Query: 201 HLSSTQIELRPRLDKELQSISAAEESISGQIQPELTACHPAPPIMPPVVLTNDVTLQSSP 22 +L +IEL+P LDKE + SAAEESISGQ+Q E+TA P +PP++ ++V L+ S Sbjct: 169 NLKRMKIELQPNLDKE--TTSAAEESISGQLQQEVTAFRP----VPPLISDSNVALKPS- 221 Query: 21 TSNACPE 1 TS+A PE Sbjct: 222 TSDANPE 228