BLASTX nr result
ID: Rehmannia29_contig00020729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00020729 (880 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17611.1| hypothetical protein CDL12_09724 [Handroanthus im... 61 1e-06 gb|KZV48156.1| pentatricopeptide repeat-containing protein-like ... 59 7e-06 >gb|PIN17611.1| hypothetical protein CDL12_09724 [Handroanthus impetiginosus] Length = 757 Score = 60.8 bits (146), Expect = 1e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 718 STGSPFVHVAYSHKFFTNIENSNGFMWNTMLTALI 822 ST SPF+HV YS K FTNIENSNGF+WNTML A + Sbjct: 69 STDSPFIHVDYSRKIFTNIENSNGFIWNTMLRAFV 103 >gb|KZV48156.1| pentatricopeptide repeat-containing protein-like [Dorcoceras hygrometricum] Length = 823 Score = 58.5 bits (140), Expect = 7e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 718 STGSPFVHVAYSHKFFTNIENSNGFMWNTMLTA 816 STGSPFVH+ YS K F NI+NSNGF+WNTML A Sbjct: 186 STGSPFVHIDYSDKLFINIQNSNGFIWNTMLRA 218