BLASTX nr result
ID: Rehmannia29_contig00020719
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00020719 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222277.1| hypothetical protein BevumaM_p039 (mitochond... 62 3e-09 >ref|YP_004222277.1| hypothetical protein BevumaM_p039 (mitochondrion) [Beta vulgaris subsp. maritima] ref|YP_004842084.1| hypothetical protein BemaM_p037 (mitochondrion) [Beta macrocarpa] emb|CBX33240.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBX33292.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ23359.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBX24886.1| hypothetical protein (mitochondrion) [Beta macrocarpa] emb|CBL52045.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 102 Score = 61.6 bits (148), Expect = 3e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 514 QFLRKLFLTSQVVQQLYLTARRGGSPFEFSR 422 QFLRKLFLTSQVVQQLYL ARRGGSPFEFSR Sbjct: 72 QFLRKLFLTSQVVQQLYLIARRGGSPFEFSR 102