BLASTX nr result
ID: Rehmannia29_contig00020425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00020425 (1193 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31369.1| hypothetical protein MIMGU_mgv1a013110mg [Erythra... 62 3e-07 ref|XP_012844659.1| PREDICTED: nuclear transcription factor Y su... 62 5e-07 >gb|EYU31369.1| hypothetical protein MIMGU_mgv1a013110mg [Erythranthe guttata] Length = 230 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 116 RSYKQDDTNLQQVESTLFPRRDGSLTQPAQLELVGHSI 3 R K+D+TNLQQVE TL PR DGSLTQP QLELVGHSI Sbjct: 46 RDRKEDNTNLQQVEPTLHPRPDGSLTQPMQLELVGHSI 83 >ref|XP_012844659.1| PREDICTED: nuclear transcription factor Y subunit A-1 [Erythranthe guttata] ref|XP_012844660.1| PREDICTED: nuclear transcription factor Y subunit A-1 [Erythranthe guttata] Length = 271 Score = 61.6 bits (148), Expect = 5e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 116 RSYKQDDTNLQQVESTLFPRRDGSLTQPAQLELVGHSI 3 R K+D+TNLQQVE TL PR DGSLTQP QLELVGHSI Sbjct: 87 RDRKEDNTNLQQVEPTLHPRPDGSLTQPMQLELVGHSI 124