BLASTX nr result
ID: Rehmannia29_contig00020300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00020300 (621 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN05035.1| hypothetical protein CDL12_22427 [Handroanthus im... 76 1e-12 ref|XP_011074161.1| ethylene-responsive transcription factor RAP... 73 1e-11 ref|XP_012838916.1| PREDICTED: ethylene-responsive transcription... 64 2e-08 ref|XP_011098323.1| ethylene-responsive transcription factor RAP... 60 4e-07 gb|PIN24728.1| hypothetical protein CDL12_02538 [Handroanthus im... 60 5e-07 ref|XP_022894462.1| ethylene-responsive transcription factor RAP... 59 7e-07 ref|XP_022880107.1| ethylene-responsive transcription factor RAP... 59 1e-06 >gb|PIN05035.1| hypothetical protein CDL12_22427 [Handroanthus impetiginosus] Length = 348 Score = 75.9 bits (185), Expect = 1e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 500 MAATMDFWSSTPVVDPFNGGELMEALEPFMKSAISTPHSS 619 MAATMDFWSSTPVVDPF GGELMEALEPFMKSA S P+SS Sbjct: 1 MAATMDFWSSTPVVDPFRGGELMEALEPFMKSASSPPNSS 40 >ref|XP_011074161.1| ethylene-responsive transcription factor RAP2-13 [Sesamum indicum] Length = 330 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 500 MAATMDFWSSTPVVDPFNGGELMEALEPFMKSAISTPHSS 619 MAATMDFWSS+PVVDP GGELME LEPFMKSA S PHSS Sbjct: 1 MAATMDFWSSSPVVDPLGGGELMEVLEPFMKSASSPPHSS 40 >ref|XP_012838916.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Erythranthe guttata] gb|EYU36517.1| hypothetical protein MIMGU_mgv1a009828mg [Erythranthe guttata] Length = 330 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = +2 Query: 500 MAATMDFWSSTP--VVDPFNGGELMEALEPFMKSAISTPHSS 619 MAAT+DFWSS+ VVDPFNGGELMEAL PFMK A STP SS Sbjct: 1 MAATLDFWSSSEPVVVDPFNGGELMEALGPFMKRASSTPLSS 42 >ref|XP_011098323.1| ethylene-responsive transcription factor RAP2-13-like [Sesamum indicum] Length = 343 Score = 60.1 bits (144), Expect = 4e-07 Identities = 31/41 (75%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +2 Query: 500 MAATMDFWSS-TPVVDPFNGGELMEALEPFMKSAISTPHSS 619 M + DFWSS TP VD FNGGELMEALEPFMKSA S P SS Sbjct: 1 MGTSTDFWSSGTPFVDSFNGGELMEALEPFMKSASSPPLSS 41 >gb|PIN24728.1| hypothetical protein CDL12_02538 [Handroanthus impetiginosus] Length = 326 Score = 59.7 bits (143), Expect = 5e-07 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = +2 Query: 500 MAATMDFWSSTPVVDPFNGGELMEALEPFMKSAISTPHSS 619 MA TMDF S PV DPF GGELMEALEPFMKSA STP SS Sbjct: 1 MATTMDFCSK-PVADPFMGGELMEALEPFMKSASSTPLSS 39 >ref|XP_022894462.1| ethylene-responsive transcription factor RAP2-4-like [Olea europaea var. sylvestris] Length = 327 Score = 59.3 bits (142), Expect = 7e-07 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +2 Query: 500 MAATMDFWSSTP-VVDPFNGGELMEALEPFMKSAIST 607 MA MDFWSS+ VVDPF GGELMEALEPFMKSA ST Sbjct: 1 MAVAMDFWSSSASVVDPFRGGELMEALEPFMKSASST 37 >ref|XP_022880107.1| ethylene-responsive transcription factor RAP2-13-like [Olea europaea var. sylvestris] Length = 340 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/42 (73%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = +2 Query: 500 MAATMDFWSSTP---VVDPFNGGELMEALEPFMKSAISTPHS 616 MAA MDFWSS+ VVDPF GGELMEAL PFM+SA STP S Sbjct: 1 MAAAMDFWSSSSSNSVVDPFRGGELMEALLPFMRSASSTPLS 42