BLASTX nr result
ID: Rehmannia29_contig00020192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00020192 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853908.1| PREDICTED: BTB/POZ and TAZ domain-containing... 130 7e-33 gb|PIN06121.1| CREB binding protein/P300 [Handroanthus impetigin... 121 1e-29 ref|XP_020554983.1| BTB/POZ and TAZ domain-containing protein 4 ... 119 1e-28 ref|XP_011099367.1| BTB/POZ and TAZ domain-containing protein 4 ... 119 1e-28 gb|KZV24606.1| BTB/POZ and TAZ domain-containing protein 4 [Dorc... 104 6e-23 ref|XP_009604071.1| PREDICTED: BTB/POZ and TAZ domain-containing... 99 6e-21 ref|XP_019266630.1| PREDICTED: BTB/POZ and TAZ domain-containing... 97 2e-20 gb|POF25631.1| btb/poz and taz domain-containing protein 4 [Quer... 92 2e-20 ref|XP_016479665.1| PREDICTED: BTB/POZ and TAZ domain-containing... 96 8e-20 ref|XP_009759977.1| PREDICTED: BTB/POZ and TAZ domain-containing... 95 1e-19 ref|XP_023915796.1| BTB/POZ and TAZ domain-containing protein 4-... 92 1e-18 ref|XP_016441815.1| PREDICTED: BTB/POZ and TAZ domain-containing... 91 3e-18 ref|XP_009787049.1| PREDICTED: BTB/POZ and TAZ domain-containing... 91 4e-18 gb|PHT56768.1| BTB/POZ and TAZ domain-containing protein 4 [Caps... 90 7e-18 ref|XP_015064154.1| PREDICTED: BTB/POZ and TAZ domain-containing... 89 1e-17 ref|XP_010316014.1| PREDICTED: BTB/POZ and TAZ domain-containing... 89 2e-17 gb|PHU27323.1| BTB/POZ and TAZ domain-containing protein 4 [Caps... 87 9e-17 ref|XP_016560955.1| PREDICTED: BTB/POZ and TAZ domain-containing... 87 9e-17 ref|XP_018809310.1| PREDICTED: BTB/POZ and TAZ domain-containing... 86 2e-16 ref|XP_018809309.1| PREDICTED: BTB/POZ and TAZ domain-containing... 86 2e-16 >ref|XP_012853908.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Erythranthe guttata] gb|EYU44484.1| hypothetical protein MIMGU_mgv1a008185mg [Erythranthe guttata] Length = 382 Score = 130 bits (327), Expect = 7e-33 Identities = 67/93 (72%), Positives = 76/93 (81%), Gaps = 7/93 (7%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTRFHQK------SKIRGLCCV-SNAINSSMDRL 161 MDRRNEESPS + K+LP PPP+P HFNTRFH K SKIRG + S A+NSS DRL Sbjct: 1 MDRRNEESPSRMEKSLPHPPPMPPHFNTRFHHKGLIITGSKIRGHSFLPSIAVNSSWDRL 60 Query: 160 FDEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 FDEGYRADV+ILTDDGGVIYAH++ILGVVSP+F Sbjct: 61 FDEGYRADVTILTDDGGVIYAHSSILGVVSPIF 93 >gb|PIN06121.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 375 Score = 121 bits (304), Expect = 1e-29 Identities = 64/92 (69%), Positives = 68/92 (73%), Gaps = 6/92 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTRFHQ------KSKIRGLCCVSNAINSSMDRLF 158 MD +N ESPSTL KALPIPPPLP H TRFHQ + KIRG +NSS DRLF Sbjct: 1 MDCKNVESPSTLEKALPIPPPLPCHLKTRFHQAGLVITRPKIRGY----GVVNSSWDRLF 56 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 DE YRADVSILTD GGV+YAHANILGV SPVF Sbjct: 57 DEAYRADVSILTDGGGVVYAHANILGVASPVF 88 >ref|XP_020554983.1| BTB/POZ and TAZ domain-containing protein 4 isoform X2 [Sesamum indicum] Length = 379 Score = 119 bits (298), Expect = 1e-28 Identities = 62/91 (68%), Positives = 70/91 (76%), Gaps = 5/91 (5%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTRFHQKS-KIRG----LCCVSNAINSSMDRLFD 155 MD RN++SPSTL P+PPPL F TRFHQK K+ G LCC+ N N+S DRLFD Sbjct: 8 MDSRNKKSPSTL----PLPPPLSPDFITRFHQKGLKMTGSNIRLCCIPNVTNTSWDRLFD 63 Query: 154 EGYRADVSILTDDGGVIYAHANILGVVSPVF 62 EGYRAD+SILTDDGGVIYAHA+ILGV SPVF Sbjct: 64 EGYRADISILTDDGGVIYAHASILGVASPVF 94 >ref|XP_011099367.1| BTB/POZ and TAZ domain-containing protein 4 isoform X1 [Sesamum indicum] Length = 380 Score = 119 bits (298), Expect = 1e-28 Identities = 62/91 (68%), Positives = 70/91 (76%), Gaps = 5/91 (5%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTRFHQKS-KIRG----LCCVSNAINSSMDRLFD 155 MD RN++SPSTL P+PPPL F TRFHQK K+ G LCC+ N N+S DRLFD Sbjct: 9 MDSRNKKSPSTL----PLPPPLSPDFITRFHQKGLKMTGSNIRLCCIPNVTNTSWDRLFD 64 Query: 154 EGYRADVSILTDDGGVIYAHANILGVVSPVF 62 EGYRAD+SILTDDGGVIYAHA+ILGV SPVF Sbjct: 65 EGYRADISILTDDGGVIYAHASILGVASPVF 95 >gb|KZV24606.1| BTB/POZ and TAZ domain-containing protein 4 [Dorcoceras hygrometricum] Length = 455 Score = 104 bits (260), Expect = 6e-23 Identities = 53/76 (69%), Positives = 58/76 (76%), Gaps = 6/76 (7%) Frame = -1 Query: 274 LPIPPPLPSHFNTRFHQK------SKIRGLCCVSNAINSSMDRLFDEGYRADVSILTDDG 113 LP+PPPLP H NTR +Q+ SK RG CC S++IN MDRLFDE YRADVSILTDDG Sbjct: 17 LPVPPPLPVHLNTRSYQRGLSTSGSKGRGHCCSSDSINDPMDRLFDEAYRADVSILTDDG 76 Query: 112 GVIYAHANILGVVSPV 65 GVIYAHA ILG SPV Sbjct: 77 GVIYAHACILGNASPV 92 >ref|XP_009604071.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] ref|XP_009604072.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] ref|XP_018627202.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] Length = 380 Score = 98.6 bits (244), Expect = 6e-21 Identities = 52/93 (55%), Positives = 64/93 (68%), Gaps = 7/93 (7%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTR-------FHQKSKIRGLCCVSNAINSSMDRL 161 M+ RNEESP V+ALP PPPLP F T +KS +R CC AI ++ D L Sbjct: 1 MNSRNEESPR--VRALPNPPPLPVAFTTSRLEINIFVTRKSAVRKYCCTPTAIKNTWDCL 58 Query: 160 FDEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 FDEGYRAD+SI TD+GG++YAHA+ILG+ SPVF Sbjct: 59 FDEGYRADISINTDNGGILYAHASILGMNSPVF 91 >ref|XP_019266630.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Nicotiana attenuata] gb|OIT34921.1| btbpoz and taz domain-containing protein 4 [Nicotiana attenuata] Length = 379 Score = 97.1 bits (240), Expect = 2e-20 Identities = 53/92 (57%), Positives = 66/92 (71%), Gaps = 6/92 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHF-NTRFH-----QKSKIRGLCCVSNAINSSMDRLF 158 M+ RNEESP V+ALP PPPLP F N+R +KS +R CC +A ++ D LF Sbjct: 1 MNSRNEESPR--VRALPNPPPLPVSFTNSRQEIKFVTRKSAVRKYCCTPSATKNTWDCLF 58 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 DEGYRADVSI TD+GG++YAHA+ILG+ SPVF Sbjct: 59 DEGYRADVSINTDNGGILYAHASILGMNSPVF 90 >gb|POF25631.1| btb/poz and taz domain-containing protein 4 [Quercus suber] Length = 157 Score = 92.4 bits (228), Expect = 2e-20 Identities = 49/91 (53%), Positives = 58/91 (63%), Gaps = 6/91 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTRFHQK------SKIRGLCCVSNAINSSMDRLF 158 MD E SP + P+ PPLP + ++QK S+ RG CCVS + DRLF Sbjct: 1 MDNIIEVSPLADERVAPMAPPLPGTATSSYNQKGYLMNGSQQRGYCCVSTSTKELWDRLF 60 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPV 65 DEGYRADVSI TD+GG IYAHANILG+ SPV Sbjct: 61 DEGYRADVSINTDNGGTIYAHANILGMASPV 91 >ref|XP_016479665.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 380 Score = 95.5 bits (236), Expect = 8e-20 Identities = 51/93 (54%), Positives = 62/93 (66%), Gaps = 7/93 (7%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTR-------FHQKSKIRGLCCVSNAINSSMDRL 161 M+ RNEESP V+ALP PPPLP F T +KS +R CC A ++ D L Sbjct: 1 MNSRNEESPR--VRALPNPPPLPVAFTTSRLEINIFVTRKSAVRKYCCTPTATKNTWDCL 58 Query: 160 FDEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 FDEGYRADVSI TD+GG++YAH +ILG+ SPVF Sbjct: 59 FDEGYRADVSINTDNGGILYAHTSILGMNSPVF 91 >ref|XP_009759977.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] ref|XP_009759978.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] ref|XP_009759979.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] ref|XP_016434919.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] ref|XP_016434920.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] ref|XP_016434921.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] ref|XP_016434922.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] ref|XP_016434923.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] ref|XP_016434924.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 379 Score = 95.1 bits (235), Expect = 1e-19 Identities = 52/92 (56%), Positives = 65/92 (70%), Gaps = 6/92 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHF-NTRFH-----QKSKIRGLCCVSNAINSSMDRLF 158 M+ RNEESP V+ALP PPPLP F N+R +KS +R CC +A ++ D LF Sbjct: 1 MNSRNEESPG--VRALPNPPPLPVSFTNSRQEIKFVTRKSAVRKYCCTPSATKNTWDCLF 58 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 DEGYRADVSI D+GG++YAHA+ILG+ SPVF Sbjct: 59 DEGYRADVSINIDNGGILYAHASILGMNSPVF 90 >ref|XP_023915796.1| BTB/POZ and TAZ domain-containing protein 4-like [Quercus suber] ref|XP_023915804.1| BTB/POZ and TAZ domain-containing protein 4-like [Quercus suber] Length = 380 Score = 92.4 bits (228), Expect = 1e-18 Identities = 49/91 (53%), Positives = 58/91 (63%), Gaps = 6/91 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTRFHQK------SKIRGLCCVSNAINSSMDRLF 158 MD E SP + P+ PPLP + ++QK S+ RG CCVS + DRLF Sbjct: 1 MDNIIEVSPLADERVAPMAPPLPGTATSSYNQKGYLMNGSQQRGYCCVSTSTKELWDRLF 60 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPV 65 DEGYRADVSI TD+GG IYAHANILG+ SPV Sbjct: 61 DEGYRADVSINTDNGGTIYAHANILGMASPV 91 >ref|XP_016441815.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] ref|XP_016441821.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 371 Score = 91.3 bits (225), Expect = 3e-18 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 1/87 (1%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSH-FNTRFHQKSKIRGLCCVSNAINSSMDRLFDEGYR 143 MDRRNEE P + +P PPPLP++ + +RF + R C + +A ++ D LFDEGYR Sbjct: 1 MDRRNEEFPCE--RTVPNPPPLPTNLYESRFISPMRRRRHCSIFSATKNTWDCLFDEGYR 58 Query: 142 ADVSILTDDGGVIYAHANILGVVSPVF 62 AD+SI TD+GG+IYAHA ILG+ SPVF Sbjct: 59 ADLSINTDNGGIIYAHATILGMSSPVF 85 >ref|XP_009787049.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] ref|XP_009787050.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] Length = 371 Score = 90.9 bits (224), Expect = 4e-18 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 1/87 (1%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSH-FNTRFHQKSKIRGLCCVSNAINSSMDRLFDEGYR 143 MDRRNEE P + +P PPPLP++ + +RF + R C + +A + D LFDEGYR Sbjct: 1 MDRRNEEFPRE--RTVPNPPPLPTNLYESRFISPMRRRRHCSIFSATKNKWDCLFDEGYR 58 Query: 142 ADVSILTDDGGVIYAHANILGVVSPVF 62 AD+SI TD+GG+IYAHA ILG+ SPVF Sbjct: 59 ADLSINTDNGGIIYAHATILGMSSPVF 85 >gb|PHT56768.1| BTB/POZ and TAZ domain-containing protein 4 [Capsicum baccatum] Length = 379 Score = 90.1 bits (222), Expect = 7e-18 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 6/92 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHF------NTRFHQKSKIRGLCCVSNAINSSMDRLF 158 M+R++EES V+A+P PPPLP +T +KS +R CC A ++ D LF Sbjct: 1 MNRKDEES--LRVRAVPNPPPLPVALTRSRQESTFVARKSAVRKYCCAPTATKNTWDCLF 58 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 DEGYRADVSI TD GG++YAHA+ILGV SPVF Sbjct: 59 DEGYRADVSINTDSGGILYAHASILGVNSPVF 90 >ref|XP_015064154.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Solanum pennellii] Length = 379 Score = 89.4 bits (220), Expect = 1e-17 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 6/92 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHF------NTRFHQKSKIRGLCCVSNAINSSMDRLF 158 M +++EESP V A P PPPLP F +T +KS +R CC A ++ D LF Sbjct: 1 MSKKDEESPR--VSASPNPPPLPVAFISSRQESTFAARKSALRKYCCTPTATKNTWDCLF 58 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 DEGYRADVSI TD+GGV+YAHA+ILGV S VF Sbjct: 59 DEGYRADVSINTDNGGVLYAHASILGVNSAVF 90 >ref|XP_010316014.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Solanum lycopersicum] Length = 379 Score = 89.0 bits (219), Expect = 2e-17 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 6/92 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHF------NTRFHQKSKIRGLCCVSNAINSSMDRLF 158 M +++EESP V A P PPPLP F T +KS +R CC A ++ D LF Sbjct: 1 MSKKDEESPR--VSASPNPPPLPVAFISSRQERTFAARKSALRKYCCTPTATKNTWDCLF 58 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 DEGYRADVSI TD+GGV+YAHA+ILGV S VF Sbjct: 59 DEGYRADVSINTDNGGVLYAHASILGVNSAVF 90 >gb|PHU27323.1| BTB/POZ and TAZ domain-containing protein 4 [Capsicum chinense] Length = 379 Score = 87.0 bits (214), Expect = 9e-17 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 6/92 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHF------NTRFHQKSKIRGLCCVSNAINSSMDRLF 158 M+R++EES V+A+P PPPLP +T +KS +R CC A ++ D LF Sbjct: 1 MNRKDEES--LRVRAVPNPPPLPVALTRSRQESTFVARKSAVRKYCCAPTATKNTWDYLF 58 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 DEGYRADVSI TD GG++ AHA+ILGV SPVF Sbjct: 59 DEGYRADVSINTDSGGILCAHASILGVNSPVF 90 >ref|XP_016560955.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Capsicum annuum] ref|XP_016560956.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Capsicum annuum] Length = 379 Score = 87.0 bits (214), Expect = 9e-17 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 6/92 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHF------NTRFHQKSKIRGLCCVSNAINSSMDRLF 158 M+R++EES V+ +P PPPLP +T +KS +R CC A ++ D LF Sbjct: 1 MNRKDEES--LRVRVVPNPPPLPVALTRSRQESTFVARKSAVRKYCCAPTATKNTWDCLF 58 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPVF 62 DEGYRADVSI TD GG++Y HA+ILGV SPVF Sbjct: 59 DEGYRADVSINTDSGGILYVHASILGVNSPVF 90 >ref|XP_018809310.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like isoform X3 [Juglans regia] Length = 383 Score = 86.3 bits (212), Expect = 2e-16 Identities = 47/91 (51%), Positives = 58/91 (63%), Gaps = 6/91 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTRFHQK------SKIRGLCCVSNAINSSMDRLF 158 +D +E SP K++P+ PPLPS T + K SK+RG VS A +RLF Sbjct: 4 VDSISEGSPVVSEKSVPVAPPLPSPATTIYCHKGLARNGSKLRGYSRVSTATKDLWERLF 63 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPV 65 DEGYRADV+I DDGG IYAHA+ILG+ SPV Sbjct: 64 DEGYRADVTINNDDGGTIYAHASILGMASPV 94 >ref|XP_018809309.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like isoform X2 [Juglans regia] Length = 390 Score = 86.3 bits (212), Expect = 2e-16 Identities = 47/91 (51%), Positives = 58/91 (63%), Gaps = 6/91 (6%) Frame = -1 Query: 319 MDRRNEESPSTLVKALPIPPPLPSHFNTRFHQK------SKIRGLCCVSNAINSSMDRLF 158 +D +E SP K++P+ PPLPS T + K SK+RG VS A +RLF Sbjct: 11 VDSISEGSPVVSEKSVPVAPPLPSPATTIYCHKGLARNGSKLRGYSRVSTATKDLWERLF 70 Query: 157 DEGYRADVSILTDDGGVIYAHANILGVVSPV 65 DEGYRADV+I DDGG IYAHA+ILG+ SPV Sbjct: 71 DEGYRADVTINNDDGGTIYAHASILGMASPV 101