BLASTX nr result
ID: Rehmannia29_contig00019972
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00019972 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26243.1| Molecular chaperone (DnaJ superfamily) [Handroant... 104 7e-26 ref|XP_011092835.1| mitochondrial import inner membrane transloc... 102 3e-25 ref|XP_019162613.1| PREDICTED: mitochondrial import inner membra... 101 1e-24 ref|XP_008792086.1| PREDICTED: mitochondrial import inner membra... 99 7e-24 ref|XP_012830994.1| PREDICTED: mitochondrial import inner membra... 99 7e-24 ref|XP_018676392.1| PREDICTED: mitochondrial import inner membra... 98 7e-24 ref|XP_020578133.1| mitochondrial import inner membrane transloc... 98 1e-23 ref|XP_019265530.1| PREDICTED: mitochondrial import inner membra... 99 1e-23 ref|XP_022966723.1| mitochondrial import inner membrane transloc... 99 1e-23 ref|XP_019247225.1| PREDICTED: mitochondrial import inner membra... 99 1e-23 ref|XP_009384310.1| PREDICTED: mitochondrial import inner membra... 98 2e-23 ref|XP_022966720.1| mitochondrial import inner membrane transloc... 99 2e-23 ref|XP_020578131.1| mitochondrial import inner membrane transloc... 98 3e-23 ref|XP_011653595.1| PREDICTED: mitochondrial import inner membra... 98 3e-23 ref|XP_008449278.1| PREDICTED: mitochondrial import inner membra... 98 3e-23 gb|OIT35653.1| mitochondrial import inner membrane translocase s... 99 3e-23 ref|XP_022856408.1| mitochondrial import inner membrane transloc... 97 4e-23 gb|PHT36438.1| Mitochondrial import inner membrane translocase s... 97 4e-23 ref|XP_016543087.1| PREDICTED: mitochondrial import inner membra... 97 4e-23 gb|KZV48169.1| hypothetical protein F511_25958 [Dorcoceras hygro... 98 5e-23 >gb|PIN26243.1| Molecular chaperone (DnaJ superfamily) [Handroanthus impetiginosus] Length = 112 Score = 104 bits (259), Expect = 7e-26 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTPPDK++EAHRRVMVANHPDAGGSHYLASKINEAKDVLLGK+KSSDSAF Sbjct: 61 RESTPPDKVREAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKSKSSDSAF 112 >ref|XP_011092835.1| mitochondrial import inner membrane translocase subunit TIM14-1 [Sesamum indicum] Length = 112 Score = 102 bits (255), Expect = 3e-25 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK++EAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF Sbjct: 61 RESTPADKVREAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 112 >ref|XP_019162613.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Ipomoea nil] Length = 112 Score = 101 bits (251), Expect = 1e-24 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK+KEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSS SAF Sbjct: 61 RESTPADKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSGSAF 112 >ref|XP_008792086.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-2-like [Phoenix dactylifera] Length = 112 Score = 99.4 bits (246), Expect = 7e-24 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTPPDKIK+AHR+VMVANHPDAGGSHYLASKINEAKDVLLGKTK SAF Sbjct: 61 RESTPPDKIKDAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKTKGGGSAF 112 >ref|XP_012830994.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Erythranthe guttata] gb|EYU42589.1| hypothetical protein MIMGU_mgv1a016665mg [Erythranthe guttata] Length = 112 Score = 99.4 bits (246), Expect = 7e-24 Identities = 45/52 (86%), Positives = 51/52 (98%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK++EAHRRVMVANHPDAGGSHYLASKINEAKD+++GK+KSSDSAF Sbjct: 61 RESTPQDKVREAHRRVMVANHPDAGGSHYLASKINEAKDIMMGKSKSSDSAF 112 >ref|XP_018676392.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 76 Score = 98.2 bits (243), Expect = 7e-24 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RES PPDK+KEAHR+VMVANHPDAGGSHYLASKINEAKDVLLGKTK SAF Sbjct: 25 RESAPPDKVKEAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKTKGGGSAF 76 >ref|XP_020578133.1| mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X2 [Phalaenopsis equestris] Length = 76 Score = 97.8 bits (242), Expect = 1e-23 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTPPDKI+EAHR+VMVANHPDAGGSHYLASKINEAKDVLLGK+K SAF Sbjct: 25 RESTPPDKIREAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKSKGGGSAF 76 >ref|XP_019265530.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Nicotiana attenuata] Length = 110 Score = 98.6 bits (244), Expect = 1e-23 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RE PPDK++EAHRRVM+ANHPDAGGSHYLASKINEAKDV+LGKTKSS SAF Sbjct: 59 REGAPPDKVREAHRRVMIANHPDAGGSHYLASKINEAKDVMLGKTKSSGSAF 110 >ref|XP_022966723.1| mitochondrial import inner membrane translocase subunit TIM14-1-like isoform X2 [Cucurbita maxima] ref|XP_023541262.1| mitochondrial import inner membrane translocase subunit TIM14-1-like [Cucurbita pepo subsp. pepo] ref|XP_023541263.1| mitochondrial import inner membrane translocase subunit TIM14-1-like [Cucurbita pepo subsp. pepo] Length = 112 Score = 98.6 bits (244), Expect = 1e-23 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RE+TPP+KIKEAHRRVM+ANHPDAGGSHYLASKINEAKDVLLGK+K S SAF Sbjct: 61 RENTPPEKIKEAHRRVMIANHPDAGGSHYLASKINEAKDVLLGKSKGSPSAF 112 >ref|XP_019247225.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Nicotiana attenuata] gb|OIT01999.1| mitochondrial import inner membrane translocase subunit tim14-1 [Nicotiana attenuata] Length = 112 Score = 98.6 bits (244), Expect = 1e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTPPDK++EAHR+VMVANHPDAGGSHYLASKINEAKD+L GKTK+S SAF Sbjct: 61 RESTPPDKVREAHRKVMVANHPDAGGSHYLASKINEAKDILTGKTKNSGSAF 112 >ref|XP_009384310.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3 isoform X1 [Musa acuminata subsp. malaccensis] Length = 112 Score = 98.2 bits (243), Expect = 2e-23 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RES PPDK+KEAHR+VMVANHPDAGGSHYLASKINEAKDVLLGKTK SAF Sbjct: 61 RESAPPDKVKEAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKTKGGGSAF 112 >ref|XP_022966720.1| mitochondrial import inner membrane translocase subunit TIM14-1-like isoform X1 [Cucurbita maxima] ref|XP_022966722.1| mitochondrial import inner membrane translocase subunit TIM14-1-like isoform X1 [Cucurbita maxima] Length = 130 Score = 98.6 bits (244), Expect = 2e-23 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RE+TPP+KIKEAHRRVM+ANHPDAGGSHYLASKINEAKDVLLGK+K S SAF Sbjct: 79 RENTPPEKIKEAHRRVMIANHPDAGGSHYLASKINEAKDVLLGKSKGSPSAF 130 >ref|XP_020578131.1| mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X1 [Phalaenopsis equestris] ref|XP_020578132.1| mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X1 [Phalaenopsis equestris] Length = 112 Score = 97.8 bits (242), Expect = 3e-23 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTPPDKI+EAHR+VMVANHPDAGGSHYLASKINEAKDVLLGK+K SAF Sbjct: 61 RESTPPDKIREAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKSKGGGSAF 112 >ref|XP_011653595.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Cucumis sativus] gb|KGN54184.1| hypothetical protein Csa_4G292450 [Cucumis sativus] Length = 112 Score = 97.8 bits (242), Expect = 3e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK+KEAHR+VMVANHPDAGGSHYLASKINEAKD+LLGKT+ S+SAF Sbjct: 61 RESTPTDKVKEAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTRGSNSAF 112 >ref|XP_008449278.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Cucumis melo] Length = 112 Score = 97.8 bits (242), Expect = 3e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK+KEAHR+VMVANHPDAGGSHYLASKINEAKD+LLGKT+ S+SAF Sbjct: 61 RESTPTDKVKEAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTRGSNSAF 112 >gb|OIT35653.1| mitochondrial import inner membrane translocase subunit tim14-1, partial [Nicotiana attenuata] Length = 137 Score = 98.6 bits (244), Expect = 3e-23 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RE PPDK++EAHRRVM+ANHPDAGGSHYLASKINEAKDV+LGKTKSS SAF Sbjct: 86 REGAPPDKVREAHRRVMIANHPDAGGSHYLASKINEAKDVMLGKTKSSGSAF 137 >ref|XP_022856408.1| mitochondrial import inner membrane translocase subunit TIM14-3-like [Olea europaea var. sylvestris] Length = 112 Score = 97.4 bits (241), Expect = 4e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK++EAHRRVMVANHPDAGGSHYLASKINEAKD+L+GK+KSS SAF Sbjct: 61 RESTPADKVREAHRRVMVANHPDAGGSHYLASKINEAKDILMGKSKSSGSAF 112 >gb|PHT36438.1| Mitochondrial import inner membrane translocase subunit TIM14, partial [Capsicum baccatum] gb|PHT70604.1| Mitochondrial import inner membrane translocase subunit TIM14, partial [Capsicum annuum] gb|PHU05142.1| Mitochondrial import inner membrane translocase subunit TIM14, partial [Capsicum chinense] Length = 112 Score = 97.4 bits (241), Expect = 4e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK++EAHR+VMVANHPDAGGSHYLASKINEAKD+LLGKTK+S SAF Sbjct: 61 RESTPADKVREAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTKNSGSAF 112 >ref|XP_016543087.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Capsicum annuum] Length = 112 Score = 97.4 bits (241), Expect = 4e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK++EAHR+VMVANHPDAGGSHYLASKINEAKD+LLGKTK+S SAF Sbjct: 61 RESTPADKVREAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTKNSGSAF 112 >gb|KZV48169.1| hypothetical protein F511_25958 [Dorcoceras hygrometricum] Length = 132 Score = 97.8 bits (242), Expect = 5e-23 Identities = 44/52 (84%), Positives = 51/52 (98%) Frame = +1 Query: 1 RESTPPDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 156 RESTP DK++EAHRRVMVANHPDAGGSHYLASKINEAKD++LGK+++SDSAF Sbjct: 81 RESTPADKVREAHRRVMVANHPDAGGSHYLASKINEAKDIILGKSRNSDSAF 132