BLASTX nr result
ID: Rehmannia29_contig00019847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00019847 (1078 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012857118.1| PREDICTED: uncharacterized protein LOC105976... 58 7e-06 >ref|XP_012857118.1| PREDICTED: uncharacterized protein LOC105976386 [Erythranthe guttata] gb|EYU20985.1| hypothetical protein MIMGU_mgv1a011470mg [Erythranthe guttata] Length = 280 Score = 58.2 bits (139), Expect = 7e-06 Identities = 29/40 (72%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +1 Query: 961 DLYFSLVL-ISAGCPYSCVNMAPHAFKFSSVTGTACATSQ 1077 D++ + VL I GCPYSCVNMAPHAFK SSVTGTA AT Q Sbjct: 167 DVFVNQVLCIGKGCPYSCVNMAPHAFKLSSVTGTAEATCQ 206