BLASTX nr result
ID: Rehmannia29_contig00019296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00019296 (933 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN09487.1| Serine/threonine protein kinase [Handroanthus imp... 67 1e-08 ref|XP_021990532.1| inactive protein kinase SELMODRAFT_444075-li... 59 8e-06 ref|XP_011077956.1| inactive protein kinase SELMODRAFT_444075 [S... 59 8e-06 >gb|PIN09487.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 657 Score = 67.0 bits (162), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 834 EISRNALTWALTNVVRPGDCVRLLVLIPTHNSS 932 EISRNALTWALTNVVRPGDC+RLLV+IPTH+SS Sbjct: 30 EISRNALTWALTNVVRPGDCIRLLVVIPTHSSS 62 >ref|XP_021990532.1| inactive protein kinase SELMODRAFT_444075-like [Helianthus annuus] gb|OTG13323.1| putative tyrosine-protein kinase, active site protein [Helianthus annuus] Length = 615 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 834 EISRNALTWALTNVVRPGDCVRLLVLIPTHNSS 932 EISRNAL WALT+VV+PGDC +LLV+IPTH SS Sbjct: 20 EISRNALIWALTHVVQPGDCAKLLVVIPTHTSS 52 >ref|XP_011077956.1| inactive protein kinase SELMODRAFT_444075 [Sesamum indicum] ref|XP_020549748.1| inactive protein kinase SELMODRAFT_444075 [Sesamum indicum] Length = 658 Score = 58.5 bits (140), Expect = 8e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 834 EISRNALTWALTNVVRPGDCVRLLVLIPTHNS 929 EISR ALTWALTNVV+PGD VRLLV+IP+HNS Sbjct: 18 EISRTALTWALTNVVQPGDSVRLLVVIPSHNS 49