BLASTX nr result
ID: Rehmannia29_contig00019227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00019227 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN09160.1| putative unusual protein kinase [Handroanthus imp... 56 6e-06 >gb|PIN09160.1| putative unusual protein kinase [Handroanthus impetiginosus] Length = 626 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = -2 Query: 132 MSRLLTVGVIKRVSLTFQTNQASILSQGPNYGALFGTRLCSPQY 1 MSRLLTVG I+RVS F TNQ I S GPN+G L G L P+Y Sbjct: 1 MSRLLTVGAIRRVSFFFGTNQTCIYSHGPNHGTLVGANLSCPRY 44