BLASTX nr result
ID: Rehmannia29_contig00019011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00019011 (567 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078855.1| protein ABHD18 [Sesamum indicum] 65 5e-09 gb|PIN19995.1| hypothetical protein CDL12_07320 [Handroanthus im... 64 2e-08 ref|XP_022842256.1| protein ABHD18 [Olea europaea var. sylvestris] 63 3e-08 gb|EPS73159.1| hypothetical protein M569_01592 [Genlisea aurea] 61 2e-07 ref|XP_019243058.1| PREDICTED: protein ABHD18 [Nicotiana attenua... 60 3e-07 gb|KZV44786.1| hypothetical protein F511_28375 [Dorcoceras hygro... 60 3e-07 ref|XP_009786760.1| PREDICTED: uncharacterized protein C4orf29 h... 60 3e-07 ref|XP_009619290.1| PREDICTED: protein ABHD18 [Nicotiana tomento... 60 3e-07 ref|XP_024031202.1| protein ABHD18 [Morus notabilis] 59 1e-06 gb|OWM78949.1| hypothetical protein CDL15_Pgr003120 [Punica gran... 59 1e-06 ref|XP_018839476.1| PREDICTED: protein ABHD18 isoform X1 [Juglan... 59 1e-06 ref|XP_004136580.1| PREDICTED: uncharacterized protein C4orf29 h... 59 1e-06 gb|PON87926.1| Abhydrolase domain containing [Trema orientalis] 59 1e-06 gb|PON32867.1| Abhydrolase domain containing [Parasponia anderso... 59 1e-06 ref|XP_021894032.1| protein ABHD18 [Carica papaya] 58 1e-06 gb|PHU22567.1| hypothetical protein BC332_07674 [Capsicum chinense] 58 1e-06 gb|AFK44612.1| unknown [Lotus japonicus] 55 1e-06 gb|KDO40425.1| hypothetical protein CISIN_1g018142mg [Citrus sin... 58 2e-06 gb|ESR50293.1| hypothetical protein CICLE_v10031918mg [Citrus cl... 58 2e-06 ref|XP_015067466.1| PREDICTED: uncharacterized protein C4orf29 h... 58 2e-06 >ref|XP_011078855.1| protein ABHD18 [Sesamum indicum] Length = 360 Score = 65.1 bits (157), Expect = 5e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+GTLYYVLDHVYGALLHRTKLSPPF Sbjct: 1 MVTVNLGTLYYVLDHVYGALLHRTKLSPPF 30 >gb|PIN19995.1| hypothetical protein CDL12_07320 [Handroanthus impetiginosus] Length = 360 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+GTLYYVLDHVYGA+LHRTK+SPPF Sbjct: 1 MVTVNLGTLYYVLDHVYGAILHRTKISPPF 30 >ref|XP_022842256.1| protein ABHD18 [Olea europaea var. sylvestris] Length = 359 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+GTL+YVLDHVYGALLHRTK+SPPF Sbjct: 1 MVTVNLGTLFYVLDHVYGALLHRTKISPPF 30 >gb|EPS73159.1| hypothetical protein M569_01592 [Genlisea aurea] Length = 356 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MV VNMGTLYYVLDHVYGALLHR+K++PPF Sbjct: 1 MVAVNMGTLYYVLDHVYGALLHRSKITPPF 30 >ref|XP_019243058.1| PREDICTED: protein ABHD18 [Nicotiana attenuata] gb|OIT04355.1| hypothetical protein A4A49_34986 [Nicotiana attenuata] Length = 360 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGALLHRTK+SPPF Sbjct: 1 MVTVNLGMLHYVLDHVYGALLHRTKISPPF 30 >gb|KZV44786.1| hypothetical protein F511_28375 [Dorcoceras hygrometricum] Length = 360 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+GTLYY+LDHVYGALLHRTK+SP F Sbjct: 1 MVTVNLGTLYYLLDHVYGALLHRTKISPQF 30 >ref|XP_009786760.1| PREDICTED: uncharacterized protein C4orf29 homolog [Nicotiana sylvestris] ref|XP_016480102.1| PREDICTED: protein ABHD18-like [Nicotiana tabacum] Length = 360 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGALLHRTK+SPPF Sbjct: 1 MVTVNLGMLHYVLDHVYGALLHRTKISPPF 30 >ref|XP_009619290.1| PREDICTED: protein ABHD18 [Nicotiana tomentosiformis] ref|XP_016506430.1| PREDICTED: protein ABHD18-like [Nicotiana tabacum] Length = 360 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGALLHRTK+SPPF Sbjct: 1 MVTVNLGMLHYVLDHVYGALLHRTKISPPF 30 >ref|XP_024031202.1| protein ABHD18 [Morus notabilis] Length = 360 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTKLSPPF Sbjct: 1 MVTVNLGLLHYVLDHVYGAFMHRTKLSPPF 30 >gb|OWM78949.1| hypothetical protein CDL15_Pgr003120 [Punica granatum] gb|PKI42864.1| hypothetical protein CRG98_036662 [Punica granatum] Length = 360 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTKLSPPF Sbjct: 1 MVTVNLGMLHYVLDHVYGAFMHRTKLSPPF 30 >ref|XP_018839476.1| PREDICTED: protein ABHD18 isoform X1 [Juglans regia] ref|XP_018839477.1| PREDICTED: protein ABHD18 isoform X1 [Juglans regia] ref|XP_018839478.1| PREDICTED: protein ABHD18 isoform X2 [Juglans regia] Length = 360 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+GTL+YVLDH+YGAL++RTK+SPPF Sbjct: 1 MVTVNIGTLHYVLDHIYGALMYRTKISPPF 30 >ref|XP_004136580.1| PREDICTED: uncharacterized protein C4orf29 homolog [Cucumis sativus] gb|KGN59324.1| hypothetical protein Csa_3G810490 [Cucumis sativus] Length = 360 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTKLSPPF Sbjct: 1 MVTVNLGMLHYVLDHVYGAFMHRTKLSPPF 30 >gb|PON87926.1| Abhydrolase domain containing [Trema orientalis] Length = 361 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTKLSPPF Sbjct: 1 MVTVNLGLLHYVLDHVYGAFMHRTKLSPPF 30 >gb|PON32867.1| Abhydrolase domain containing [Parasponia andersonii] Length = 361 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTKLSPPF Sbjct: 1 MVTVNLGLLHYVLDHVYGAFMHRTKLSPPF 30 >ref|XP_021894032.1| protein ABHD18 [Carica papaya] Length = 359 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDH+YGA +HRTKLSPPF Sbjct: 1 MVTVNLGMLHYVLDHIYGAFMHRTKLSPPF 30 >gb|PHU22567.1| hypothetical protein BC332_07674 [Capsicum chinense] Length = 360 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTKLSPPF Sbjct: 1 MVTVNLGMLHYVLDHVYGAFVHRTKLSPPF 30 >gb|AFK44612.1| unknown [Lotus japonicus] Length = 98 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTK+S PF Sbjct: 1 MVTVNLGMLHYVLDHVYGAFMHRTKISTPF 30 >gb|KDO40425.1| hypothetical protein CISIN_1g018142mg [Citrus sinensis] Length = 333 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTK+SPPF Sbjct: 1 MVTVNLGMLHYVLDHVYGAFMHRTKISPPF 30 >gb|ESR50293.1| hypothetical protein CICLE_v10031918mg [Citrus clementina] Length = 333 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTK+SPPF Sbjct: 1 MVTVNLGMLHYVLDHVYGAFMHRTKISPPF 30 >ref|XP_015067466.1| PREDICTED: uncharacterized protein C4orf29 homolog [Solanum pennellii] Length = 357 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 MVTVNMGTLYYVLDHVYGALLHRTKLSPPF 3 MVTVN+G L+YVLDHVYGA +HRTKLSPPF Sbjct: 1 MVTVNIGMLHYVLDHVYGAFVHRTKLSPPF 30