BLASTX nr result
ID: Rehmannia29_contig00018993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00018993 (704 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25755.1| hypothetical protein MIMGU_mgv1a026540mg [Erythra... 69 9e-10 ref|XP_012851341.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_011094045.1| pentatricopeptide repeat-containing protein ... 68 1e-09 ref|XP_011094044.1| pentatricopeptide repeat-containing protein ... 68 1e-09 gb|PIN07100.1| hypothetical protein CDL12_20334 [Handroanthus im... 64 2e-08 ref|XP_022883048.1| pentatricopeptide repeat-containing protein ... 59 1e-06 ref|XP_022883047.1| pentatricopeptide repeat-containing protein ... 59 1e-06 ref|XP_010425791.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 ref|XP_010496527.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >gb|EYU25755.1| hypothetical protein MIMGU_mgv1a026540mg [Erythranthe guttata] Length = 400 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 703 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 VMEYVK+K+WTYKMLIS+YLKKK RSNQIFWNY Sbjct: 368 VMEYVKRKDWTYKMLISVYLKKKFRSNQIFWNY 400 >ref|XP_012851341.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Erythranthe guttata] Length = 411 Score = 68.6 bits (166), Expect = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 703 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 VMEYVK+K+WTYKMLIS+YLKKK RSNQIFWNY Sbjct: 379 VMEYVKRKDWTYKMLISVYLKKKFRSNQIFWNY 411 >ref|XP_011094045.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Sesamum indicum] Length = 419 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 703 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 VMEYVKKK+WTYKM+I+IYLKKK RSNQIFWNY Sbjct: 387 VMEYVKKKDWTYKMIIAIYLKKKFRSNQIFWNY 419 >ref|XP_011094044.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Sesamum indicum] Length = 420 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 703 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 VMEYVKKK+WTYKM+I+IYLKKK RSNQIFWNY Sbjct: 388 VMEYVKKKDWTYKMIIAIYLKKKFRSNQIFWNY 420 >gb|PIN07100.1| hypothetical protein CDL12_20334 [Handroanthus impetiginosus] Length = 347 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 703 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 V+EY KK+WTYKMLI+IYLKKK+RSNQIFWNY Sbjct: 315 VLEYAGKKDWTYKMLIAIYLKKKLRSNQIFWNY 347 >ref|XP_022883048.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Olea europaea var. sylvestris] Length = 402 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 700 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 +EY +KK WTY MLI+ YLKKK RSNQIFWNY Sbjct: 371 LEYTRKKKWTYNMLITTYLKKKFRSNQIFWNY 402 >ref|XP_022883047.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Olea europaea var. sylvestris] Length = 442 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 700 MEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 +EY +KK WTY MLI+ YLKKK RSNQIFWNY Sbjct: 411 LEYTRKKKWTYNMLITTYLKKKFRSNQIFWNY 442 >ref|XP_010425791.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Camelina sativa] Length = 421 Score = 57.4 bits (137), Expect = 6e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -2 Query: 703 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 V+E+ +KNWTY+MLI +YLKKK+R +QIFWNY Sbjct: 389 VLEFSPRKNWTYRMLIGVYLKKKLRRDQIFWNY 421 >ref|XP_010496527.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Camelina sativa] Length = 422 Score = 57.4 bits (137), Expect = 6e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -2 Query: 703 VMEYVKKKNWTYKMLISIYLKKKIRSNQIFWNY 605 V+E+ +KNWTY+MLI +YLKKK+R +QIFWNY Sbjct: 390 VLEFSPRKNWTYRMLIGVYLKKKLRRDQIFWNY 422