BLASTX nr result
ID: Rehmannia29_contig00018989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00018989 (550 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073521.1| activating signal cointegrator 1 [Sesamum in... 58 8e-07 gb|PIN04283.1| hypothetical protein CDL12_23181 [Handroanthus im... 58 1e-06 >ref|XP_011073521.1| activating signal cointegrator 1 [Sesamum indicum] Length = 254 Score = 58.2 bits (139), Expect = 8e-07 Identities = 32/56 (57%), Positives = 36/56 (64%) Frame = -2 Query: 549 LASRSNCSSLSQEEKSPSLVXXXXXXXXXATQFSKNNTFQPPTGDSIEGNEKPASS 382 LASR N S +S+EEKSPSLV ATQF+KNN P TG IE +EKP SS Sbjct: 188 LASRPNGSRISEEEKSPSLVAAIAGARAAATQFAKNNMSPPTTGGDIESDEKPVSS 243 >gb|PIN04283.1| hypothetical protein CDL12_23181 [Handroanthus impetiginosus] Length = 255 Score = 57.8 bits (138), Expect = 1e-06 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -2 Query: 549 LASRSNCSSLSQEEKSPSLVXXXXXXXXXATQFSK-NNTFQPPTGDSIEGNEKPASS 382 LAS SNCS++S+EEKSPSLV ATQFSK NNT Q + ++IE EKP SS Sbjct: 188 LASSSNCSTVSEEEKSPSLVAAIAGARAAATQFSKNNNTLQSTSRENIEDGEKPVSS 244