BLASTX nr result
ID: Rehmannia29_contig00018888
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00018888 (557 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012857393.1| PREDICTED: protein QUIRKY [Erythranthe gutta... 46 4e-07 >ref|XP_012857393.1| PREDICTED: protein QUIRKY [Erythranthe guttata] gb|EYU20879.1| hypothetical protein MIMGU_mgv1a000729mg [Erythranthe guttata] Length = 1001 Score = 45.8 bits (107), Expect(2) = 4e-07 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Frame = -2 Query: 412 KSPTEPRKSIIT*MAKNMEIEPKLF*KISSENLDRR-IAFDLVDHP*P---VRVSEA 254 KS P KS+I+ +K+MEIE KLF KI+S DRR AFDLVD P P VRV++A Sbjct: 224 KSTQNPEKSLISENSKHMEIESKLFQKINSGKADRRTTAFDLVD-PMPFLYVRVAKA 279 Score = 35.8 bits (81), Expect(2) = 4e-07 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = -3 Query: 495 NPPSTTTATPLHQPETEVNLNSPPIAQQKAPQNPE 391 N P T P P TEV PPIAQQK+ QNPE Sbjct: 198 NAPPQTPPPPTPPPPTEVQ--HPPIAQQKSTQNPE 230