BLASTX nr result
ID: Rehmannia29_contig00018744
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00018744 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17999.1| hypothetical protein CDL12_09338 [Handroanthus im... 63 1e-08 ref|XP_012852796.1| PREDICTED: probable folate-biopterin transpo... 57 1e-06 ref|XP_022849968.1| probable folate-biopterin transporter 3 [Ole... 55 6e-06 >gb|PIN17999.1| hypothetical protein CDL12_09338 [Handroanthus impetiginosus] Length = 501 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 122 MDQDEKFPLQEKQAQKEKPSKNGILGLIFSPFDFLKKLSD 3 MDQDEKFPLQE QAQK K KNG+ GL+ SPF ++KKLSD Sbjct: 1 MDQDEKFPLQENQAQKIKAPKNGVSGLVLSPFKWVKKLSD 40 >ref|XP_012852796.1| PREDICTED: probable folate-biopterin transporter 3 [Erythranthe guttata] gb|EYU24569.1| hypothetical protein MIMGU_mgv1a005024mg [Erythranthe guttata] Length = 500 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/40 (67%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -2 Query: 119 DQDEKFPLQEKQAQKEK-PSKNGILGLIFSPFDFLKKLSD 3 ++DE+ PLQEK QKEK P KNGILG+IFSPF++L +LSD Sbjct: 3 EEDERIPLQEKLPQKEKSPEKNGILGVIFSPFNWLSRLSD 42 >ref|XP_022849968.1| probable folate-biopterin transporter 3 [Olea europaea var. sylvestris] Length = 501 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -2 Query: 122 MDQDEKFPLQEKQAQKEKPSKNGILGLIFSPFDFLKKLSD 3 MD++EKFPL+E Q+ KEK KNG+ G+I SPF +LK LS+ Sbjct: 2 MDEEEKFPLEENQSHKEKVQKNGLCGMILSPFYWLKMLSE 41