BLASTX nr result
ID: Rehmannia29_contig00018244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00018244 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34757.1| hypothetical protein MIMGU_mgv1a0063952mg, partia... 69 1e-11 gb|PIN17807.1| hypothetical protein CDL12_09544 [Handroanthus im... 70 3e-11 ref|XP_011097364.1| pentatricopeptide repeat-containing protein ... 69 9e-11 ref|XP_012840703.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-10 gb|OVA20559.1| Pentatricopeptide repeat [Macleaya cordata] 68 2e-10 ref|XP_022880604.1| pentatricopeptide repeat-containing protein ... 68 2e-10 ref|XP_010265575.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-10 ref|XP_016472498.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-10 ref|XP_009631176.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-10 ref|XP_019223637.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-10 ref|XP_016478237.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-10 ref|XP_009778230.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-10 gb|AFK33608.1| unknown [Lotus japonicus] 65 4e-10 emb|CDP11275.1| unnamed protein product [Coffea canephora] 66 8e-10 ref|XP_006848937.1| pentatricopeptide repeat-containing protein ... 66 8e-10 gb|KZV55487.1| pentatricopeptide repeat-containing protein mitoc... 66 1e-09 ref|XP_021859662.1| pentatricopeptide repeat-containing protein ... 65 1e-09 ref|XP_004489548.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 ref|XP_021766997.1| pentatricopeptide repeat-containing protein ... 65 2e-09 gb|EPS68228.1| hypothetical protein M569_06540 [Genlisea aurea] 65 2e-09 >gb|EYU34757.1| hypothetical protein MIMGU_mgv1a0063952mg, partial [Erythranthe guttata] Length = 164 Score = 68.6 bits (166), Expect = 1e-11 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+G+RMQDAFFFR+EMKS+GL+PDV + Sbjct: 76 DTFHSLIIGTMKGSRMQDAFFFRDEMKSMGLIPDVALY 113 >gb|PIN17807.1| hypothetical protein CDL12_09544 [Handroanthus impetiginosus] Length = 442 Score = 70.1 bits (170), Expect = 3e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL+VGTM+GARMQDAFFFR+EMKS+GLVPDV + Sbjct: 75 DTFHSLIVGTMKGARMQDAFFFRDEMKSVGLVPDVALY 112 >ref|XP_011097364.1| pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Sesamum indicum] Length = 442 Score = 68.9 bits (167), Expect = 9e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL+VGTM+GARMQDAFFFR+EM+S+GLVPDV + Sbjct: 75 DTFHSLIVGTMKGARMQDAFFFRDEMQSMGLVPDVALY 112 >ref|XP_012840703.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Erythranthe guttata] Length = 445 Score = 68.6 bits (166), Expect = 1e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+G+RMQDAFFFR+EMKS+GL+PDV + Sbjct: 76 DTFHSLIIGTMKGSRMQDAFFFRDEMKSMGLIPDVALY 113 >gb|OVA20559.1| Pentatricopeptide repeat [Macleaya cordata] Length = 377 Score = 67.8 bits (164), Expect = 2e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+GAR+QDAFFFR+EMK++GLVPDV + Sbjct: 11 DTFHSLIIGTMKGARLQDAFFFRDEMKAMGLVPDVALY 48 >ref|XP_022880604.1| pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Olea europaea var. sylvestris] Length = 436 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL+VGTM+G+R+QDAFFFR+EMKS+GL PDV F Sbjct: 75 DTFHSLIVGTMKGSRLQDAFFFRDEMKSMGLAPDVALF 112 >ref|XP_010265575.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Nelumbo nucifera] Length = 441 Score = 67.0 bits (162), Expect = 4e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL+VGTM+GAR+QDAFFFR+EMK++GL+PDV + Sbjct: 75 DTFHSLIVGTMKGARLQDAFFFRDEMKAMGLLPDVALY 112 >ref|XP_016472498.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Nicotiana tabacum] Length = 443 Score = 67.0 bits (162), Expect = 4e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+GAR+QDAFFFR+EMK++GLVPDV + Sbjct: 75 DTFHSLLIGTMKGARLQDAFFFRDEMKAMGLVPDVALY 112 >ref|XP_009631176.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Nicotiana tomentosiformis] Length = 443 Score = 67.0 bits (162), Expect = 4e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+GAR+QDAFFFR+EMK++GLVPDV + Sbjct: 75 DTFHSLLIGTMKGARLQDAFFFRDEMKAMGLVPDVALY 112 >ref|XP_019223637.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Nicotiana attenuata] gb|OIT05725.1| pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 447 Score = 67.0 bits (162), Expect = 4e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+GAR+QDAFFFR+EMK++GLVPDV + Sbjct: 75 DTFHSLLIGTMKGARLQDAFFFRDEMKAMGLVPDVALY 112 >ref|XP_016478237.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Nicotiana tabacum] Length = 447 Score = 67.0 bits (162), Expect = 4e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+GAR+QDAFFFR+EMK++GLVPDV + Sbjct: 75 DTFHSLLIGTMKGARLQDAFFFRDEMKAMGLVPDVALY 112 >ref|XP_009778230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Nicotiana sylvestris] Length = 447 Score = 67.0 bits (162), Expect = 4e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+GAR+QDAFFFR+EMK++GLVPDV + Sbjct: 75 DTFHSLLIGTMKGARLQDAFFFRDEMKAMGLVPDVALY 112 >gb|AFK33608.1| unknown [Lotus japonicus] Length = 193 Score = 65.1 bits (157), Expect = 4e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSLVVGTMRG+RMQDAF+F N+MK +GLVPDV + Sbjct: 83 DTFHSLVVGTMRGSRMQDAFYFLNQMKIMGLVPDVTLY 120 >emb|CDP11275.1| unnamed protein product [Coffea canephora] Length = 445 Score = 66.2 bits (160), Expect = 8e-10 Identities = 26/38 (68%), Positives = 36/38 (94%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL++GTM+G+R+QDAFFFR+EMK++GL+PDV + Sbjct: 76 DTFHSLIIGTMKGSRLQDAFFFRDEMKAMGLIPDVALY 113 >ref|XP_006848937.1| pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Amborella trichopoda] gb|ERN10518.1| hypothetical protein AMTR_s00166p00033890 [Amborella trichopoda] Length = 450 Score = 66.2 bits (160), Expect = 8e-10 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 D FHSL+VGTM+GAR+QDAFFFR+EMKS+GL+PDV + Sbjct: 85 DVFHSLIVGTMKGARLQDAFFFRDEMKSMGLLPDVALY 122 >gb|KZV55487.1| pentatricopeptide repeat-containing protein mitochondrial, partial [Dorcoceras hygrometricum] Length = 433 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTF SL+VGTM+GAR+QDAFFFR+EMKS+GLVPDV + Sbjct: 66 DTFQSLIVGTMKGARLQDAFFFRDEMKSMGLVPDVLLY 103 >ref|XP_021859662.1| pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Spinacia oleracea] gb|KNA10515.1| hypothetical protein SOVF_143730 [Spinacia oleracea] Length = 440 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCFLLCFTI 132 DTFHSL+ GTM+GAR+QDAFFFR+EMK++GL+PDV + +I Sbjct: 75 DTFHSLIAGTMKGARLQDAFFFRDEMKAMGLLPDVTLYNFLISI 118 >ref|XP_004489548.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Cicer arietinum] Length = 448 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCFLLCFTI 132 DTFHSL+VGTMRG+RMQDAFFF+++M+++GLVPDV + +I Sbjct: 81 DTFHSLIVGTMRGSRMQDAFFFKDQMRTMGLVPDVTFYNFLISI 124 >ref|XP_021766997.1| pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Chenopodium quinoa] Length = 440 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 DTFHSL+ GTM+GAR+QDAFFFR+EMK++GL+PDV + Sbjct: 75 DTFHSLIAGTMKGARLQDAFFFRDEMKAMGLLPDVTLY 112 >gb|EPS68228.1| hypothetical protein M569_06540 [Genlisea aurea] Length = 440 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 1 DTFHSLVVGTMRGARMQDAFFFRNEMKSLGLVPDVCCF 114 +TFHSL++GTMRG RMQDAFFFR+EMKS+GL PDV + Sbjct: 65 ETFHSLILGTMRGGRMQDAFFFRDEMKSMGLFPDVSLY 102