BLASTX nr result
ID: Rehmannia29_contig00018140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00018140 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN05865.1| hypothetical protein CDL12_21593 [Handroanthus im... 62 1e-12 ref|XP_011097467.1| uncharacterized protein LOC105176382 [Sesamu... 59 5e-12 ref|XP_012835112.1| PREDICTED: uncharacterized protein LOC105955... 57 1e-09 emb|CDP01574.1| unnamed protein product [Coffea canephora] 48 7e-06 >gb|PIN05865.1| hypothetical protein CDL12_21593 [Handroanthus impetiginosus] gb|PIN05866.1| hypothetical protein CDL12_21594 [Handroanthus impetiginosus] Length = 211 Score = 61.6 bits (148), Expect(2) = 1e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 99 QAHRHFIQGAQFLSRARSTKTRSTAVNLAKSAV 1 QAHRHFIQGAQFLSRARSTKT+ST NLAKSAV Sbjct: 42 QAHRHFIQGAQFLSRARSTKTKSTTFNLAKSAV 74 Score = 38.5 bits (88), Expect(2) = 1e-12 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = -1 Query: 223 MEKDVXXXXXXXXXXXXIFYVLQALPKRAFNKLRSKA 113 MEKDV IFYVL +LPK+AF KLRSKA Sbjct: 1 MEKDVLVQLGILIFTLCIFYVLHSLPKQAFTKLRSKA 37 >ref|XP_011097467.1| uncharacterized protein LOC105176382 [Sesamum indicum] Length = 211 Score = 59.3 bits (142), Expect(2) = 5e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 99 QAHRHFIQGAQFLSRARSTKTRSTAVNLAKSAV 1 QAHRHFIQGAQFLSRARS KT+ST NLAKSAV Sbjct: 42 QAHRHFIQGAQFLSRARSMKTKSTVFNLAKSAV 74 Score = 38.9 bits (89), Expect(2) = 5e-12 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = -1 Query: 223 MEKDVXXXXXXXXXXXXIFYVLQALPKRAFNKLRSKA 113 MEKDV IFYVL +LPKRAF+KLRS+A Sbjct: 1 MEKDVLVQLGILIFTLCIFYVLHSLPKRAFSKLRSQA 37 >ref|XP_012835112.1| PREDICTED: uncharacterized protein LOC105955858 [Erythranthe guttata] gb|EYU39292.1| hypothetical protein MIMGU_mgv1a013758mg [Erythranthe guttata] Length = 211 Score = 56.6 bits (135), Expect(2) = 1e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 99 QAHRHFIQGAQFLSRARSTKTRSTAVNLAKSA 4 QAHRHFI GAQ LSRARSTKT+STA NLAKSA Sbjct: 42 QAHRHFILGAQLLSRARSTKTKSTAFNLAKSA 73 Score = 33.9 bits (76), Expect(2) = 1e-09 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = -1 Query: 223 MEKDVXXXXXXXXXXXXIFYVLQALPKRAFNKLRSK 116 ME+++ IFYVL +LPKR F KLRSK Sbjct: 1 MEREILLQLGILIFSLGIFYVLHSLPKRVFTKLRSK 36 >emb|CDP01574.1| unnamed protein product [Coffea canephora] Length = 214 Score = 47.8 bits (112), Expect(2) = 7e-06 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 3/35 (8%) Frame = -2 Query: 99 QAHRHFIQGAQFLSRARSTK---TRSTAVNLAKSA 4 QAHRHFI GAQFL+RARS + +STA NLAKSA Sbjct: 42 QAHRHFISGAQFLARARSVQFKNNKSTAFNLAKSA 76 Score = 29.6 bits (65), Expect(2) = 7e-06 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 169 FYVLQALPKRAFNKLRSKA 113 FY+L LPK+A +KLRSKA Sbjct: 19 FYLLHHLPKQALSKLRSKA 37