BLASTX nr result
ID: Rehmannia29_contig00018122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00018122 (600 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17043.1| Cytosine deaminase FCY1 [Handroanthus impetiginosus] 61 6e-08 ref|XP_012835883.1| PREDICTED: tRNA-specific adenosine deaminase... 60 1e-07 >gb|PIN17043.1| Cytosine deaminase FCY1 [Handroanthus impetiginosus] Length = 192 Score = 60.8 bits (146), Expect = 6e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 ATEAINLLRSFYEQGNTNAPKPHRTPMPR 88 A+EAINLLRSFYEQGN NAPKPHRTPMPR Sbjct: 163 ASEAINLLRSFYEQGNPNAPKPHRTPMPR 191 >ref|XP_012835883.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Erythranthe guttata] Length = 191 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 ATEAINLLRSFYEQGNTNAPKPHRTPMPRV 91 A EAINLLRSFYEQGN NAPKPHRTPMP++ Sbjct: 162 AAEAINLLRSFYEQGNPNAPKPHRTPMPQI 191