BLASTX nr result
ID: Rehmannia29_contig00017698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00017698 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021897912.1| callose synthase 3-like [Carica papaya] 126 5e-35 ref|XP_019097320.1| PREDICTED: callose synthase 3-like [Camelina... 127 1e-34 gb|KHN37284.1| Callose synthase 3 [Glycine soja] 123 5e-34 gb|PIN06208.1| 1,3-beta-glucan synthase [Handroanthus impetigino... 129 6e-34 gb|PPS05988.1| hypothetical protein GOBAR_AA14663 [Gossypium bar... 129 1e-33 gb|KRH36298.1| hypothetical protein GLYMA_10G295000 [Glycine max] 123 6e-33 ref|XP_006589787.1| PREDICTED: callose synthase 3-like [Glycine ... 123 6e-33 gb|KHG11224.1| Callose synthase 3 -like protein [Gossypium arbor... 129 8e-33 gb|KHG20064.1| Callose synthase 3 -like protein [Gossypium arbor... 129 2e-32 gb|OIV91209.1| hypothetical protein TanjilG_30431 [Lupinus angus... 123 3e-32 emb|CCW03267.1| similar to callose synthase [Lupinus angustifolius] 123 3e-32 ref|XP_019152063.1| PREDICTED: callose synthase 3 [Ipomoea nil] ... 130 3e-32 ref|XP_011083139.1| callose synthase 3 isoform X2 [Sesamum indicum] 130 3e-32 ref|XP_011080223.1| callose synthase 3 [Sesamum indicum] 130 3e-32 ref|XP_012828960.1| PREDICTED: callose synthase 3 [Erythranthe g... 130 3e-32 ref|XP_020550348.1| callose synthase 3 isoform X1 [Sesamum indicum] 130 3e-32 emb|CAZ15552.1| 1,3-beta-glucan synthase, partial [Malus domestica] 123 5e-32 gb|KHG15982.1| Callose synthase 3 -like protein [Gossypium arbor... 129 5e-32 gb|PIN08892.1| 1,3-beta-glucan synthase [Handroanthus impetigino... 129 8e-32 ref|XP_002304888.2| GLUCAN SYNTHASE-LIKE 9 family protein [Popul... 129 8e-32 >ref|XP_021897912.1| callose synthase 3-like [Carica papaya] Length = 91 Score = 126 bits (316), Expect = 5e-35 Identities = 60/62 (96%), Positives = 62/62 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 Q+AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 19 QRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 78 Query: 181 GG 186 GG Sbjct: 79 GG 80 >ref|XP_019097320.1| PREDICTED: callose synthase 3-like [Camelina sativa] Length = 152 Score = 127 bits (319), Expect = 1e-34 Identities = 60/62 (96%), Positives = 62/62 (100%) Frame = +1 Query: 4 KAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILG 183 +AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILG Sbjct: 81 RAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILG 140 Query: 184 GH 189 GH Sbjct: 141 GH 142 >gb|KHN37284.1| Callose synthase 3 [Glycine soja] Length = 91 Score = 123 bits (309), Expect = 5e-34 Identities = 58/62 (93%), Positives = 62/62 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 ++AGFWGSV+TLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 19 RRAGFWGSVKTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 78 Query: 181 GG 186 GG Sbjct: 79 GG 80 >gb|PIN06208.1| 1,3-beta-glucan synthase [Handroanthus impetiginosus] Length = 287 Score = 129 bits (324), Expect = 6e-34 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 Q+AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 215 QRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 274 Query: 181 GGH 189 GGH Sbjct: 275 GGH 277 >gb|PPS05988.1| hypothetical protein GOBAR_AA14663 [Gossypium barbadense] Length = 299 Score = 129 bits (323), Expect = 1e-33 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 +KAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 227 KKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 286 Query: 181 GGH 189 GGH Sbjct: 287 GGH 289 >gb|KRH36298.1| hypothetical protein GLYMA_10G295000 [Glycine max] Length = 170 Score = 123 bits (309), Expect = 6e-33 Identities = 58/62 (93%), Positives = 62/62 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 ++AGFWGSV+TLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 98 RRAGFWGSVKTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 157 Query: 181 GG 186 GG Sbjct: 158 GG 159 >ref|XP_006589787.1| PREDICTED: callose synthase 3-like [Glycine max] Length = 171 Score = 123 bits (309), Expect = 6e-33 Identities = 58/62 (93%), Positives = 62/62 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 ++AGFWGSV+TLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 99 RRAGFWGSVKTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 158 Query: 181 GG 186 GG Sbjct: 159 GG 160 >gb|KHG11224.1| Callose synthase 3 -like protein [Gossypium arboreum] Length = 404 Score = 129 bits (323), Expect = 8e-33 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 +KAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 332 KKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 391 Query: 181 GGH 189 GGH Sbjct: 392 GGH 394 >gb|KHG20064.1| Callose synthase 3 -like protein [Gossypium arboreum] Length = 445 Score = 129 bits (323), Expect = 2e-32 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 +KAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 373 KKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 432 Query: 181 GGH 189 GGH Sbjct: 433 GGH 435 >gb|OIV91209.1| hypothetical protein TanjilG_30431 [Lupinus angustifolius] Length = 227 Score = 123 bits (309), Expect = 3e-32 Identities = 58/62 (93%), Positives = 62/62 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 ++AGFWGSV+TLARGYE+IMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 155 RRAGFWGSVKTLARGYEVIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 214 Query: 181 GG 186 GG Sbjct: 215 GG 216 >emb|CCW03267.1| similar to callose synthase [Lupinus angustifolius] Length = 229 Score = 123 bits (309), Expect = 3e-32 Identities = 58/62 (93%), Positives = 62/62 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 ++AGFWGSV+TLARGYE+IMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 157 RRAGFWGSVKTLARGYEVIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 216 Query: 181 GG 186 GG Sbjct: 217 GG 218 >ref|XP_019152063.1| PREDICTED: callose synthase 3 [Ipomoea nil] ref|XP_019152064.1| PREDICTED: callose synthase 3 [Ipomoea nil] Length = 1948 Score = 130 bits (327), Expect = 3e-32 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 QKAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1877 QKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1936 Query: 181 GGH 189 GGH Sbjct: 1937 GGH 1939 >ref|XP_011083139.1| callose synthase 3 isoform X2 [Sesamum indicum] Length = 1948 Score = 130 bits (327), Expect = 3e-32 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 QKAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1876 QKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1935 Query: 181 GGH 189 GGH Sbjct: 1936 GGH 1938 >ref|XP_011080223.1| callose synthase 3 [Sesamum indicum] Length = 1948 Score = 130 bits (327), Expect = 3e-32 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 QKAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1876 QKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1935 Query: 181 GGH 189 GGH Sbjct: 1936 GGH 1938 >ref|XP_012828960.1| PREDICTED: callose synthase 3 [Erythranthe guttata] ref|XP_012828961.1| PREDICTED: callose synthase 3 [Erythranthe guttata] gb|EYU17999.1| hypothetical protein MIMGU_mgv1a000067mg [Erythranthe guttata] Length = 1948 Score = 130 bits (327), Expect = 3e-32 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 QKAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1876 QKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1935 Query: 181 GGH 189 GGH Sbjct: 1936 GGH 1938 >ref|XP_020550348.1| callose synthase 3 isoform X1 [Sesamum indicum] Length = 1950 Score = 130 bits (327), Expect = 3e-32 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 QKAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1878 QKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1937 Query: 181 GGH 189 GGH Sbjct: 1938 GGH 1940 >emb|CAZ15552.1| 1,3-beta-glucan synthase, partial [Malus domestica] Length = 238 Score = 123 bits (308), Expect = 5e-32 Identities = 59/62 (95%), Positives = 61/62 (98%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 ++AGFWGSV TLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 165 KRAGFWGSVETLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 224 Query: 181 GG 186 GG Sbjct: 225 GG 226 >gb|KHG15982.1| Callose synthase 3 -like protein [Gossypium arboreum] Length = 563 Score = 129 bits (323), Expect = 5e-32 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 +KAGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 491 KKAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 550 Query: 181 GGH 189 GGH Sbjct: 551 GGH 553 >gb|PIN08892.1| 1,3-beta-glucan synthase [Handroanthus impetiginosus] Length = 1009 Score = 129 bits (324), Expect = 8e-32 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 Q+AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 937 QRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 996 Query: 181 GGH 189 GGH Sbjct: 997 GGH 999 >ref|XP_002304888.2| GLUCAN SYNTHASE-LIKE 9 family protein [Populus trichocarpa] Length = 1852 Score = 129 bits (324), Expect = 8e-32 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +1 Query: 1 QKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 180 Q+AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1780 QRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1839 Query: 181 GGH 189 GGH Sbjct: 1840 GGH 1842