BLASTX nr result
ID: Rehmannia29_contig00017552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00017552 (572 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29767.1| hypothetical protein MIMGU_mgv1a020903mg, partial... 59 5e-07 ref|XP_012846491.1| PREDICTED: histone deacetylase 5 [Erythranth... 59 7e-07 >gb|EYU29767.1| hypothetical protein MIMGU_mgv1a020903mg, partial [Erythranthe guttata] Length = 251 Score = 58.9 bits (141), Expect = 5e-07 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +1 Query: 1 ICAPSKGYKDIMIKALVEQAELPAQVAIAYIRDSFEKPLNGSNI-HHIPC 147 IC PSK YKDI++KALVE+ L A+ YIRD ++KPL GS H+ PC Sbjct: 199 ICGPSKAYKDIIMKALVEERNLTQNQALNYIRDCYKKPLRGSIFSHYCPC 248 >ref|XP_012846491.1| PREDICTED: histone deacetylase 5 [Erythranthe guttata] Length = 326 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +1 Query: 1 ICAPSKGYKDIMIKALVEQAELPAQVAIAYIRDSFEKPLNGSNI-HHIPC 147 IC PSK YKDI++KALVE+ L A+ YIRD ++KPL GS H+ PC Sbjct: 274 ICGPSKAYKDIIMKALVEERNLTQNQALNYIRDCYKKPLRGSIFSHYCPC 323