BLASTX nr result
ID: Rehmannia29_contig00017467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00017467 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101098.1| ethylene-responsive transcription factor 5 [... 59 2e-07 gb|PIN17894.1| hypothetical protein CDL12_09442 [Handroanthus im... 57 1e-06 >ref|XP_011101098.1| ethylene-responsive transcription factor 5 [Sesamum indicum] Length = 266 Score = 59.3 bits (142), Expect = 2e-07 Identities = 33/66 (50%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = -3 Query: 227 RQHLFDDYAFMENYCPKSDL-SSDQSHISRXXXXXXXXXXXXXXXSPKLEFFEYIEFETK 51 RQHL DD AF++NYCP S L SSDQS ISR FEY+EFETK Sbjct: 15 RQHLLDDSAFIQNYCPSSALSSSDQSQISRTSSYSSSSSDQTSVYVSPKREFEYLEFETK 74 Query: 50 PEINTS 33 P+ N S Sbjct: 75 PQRNLS 80 >gb|PIN17894.1| hypothetical protein CDL12_09442 [Handroanthus impetiginosus] Length = 311 Score = 57.4 bits (137), Expect = 1e-06 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 19/94 (20%) Frame = -3 Query: 227 RQHLFDDYAFMENYCPKSD--LSSDQSH-ISR---------------XXXXXXXXXXXXX 102 RQHL DD+AFMENYCP SSDQ H ISR Sbjct: 14 RQHLLDDHAFMENYCPSDAKLSSSDQFHQISRTSSNSSCSSSSSCSIEKPAASVFMPTFS 73 Query: 101 XXSPKLEF-FEYIEFETKPEINTSNNPKKQKNFS 3 +PK E ++Y+EFETKP+I++++N KQK+F+ Sbjct: 74 FFTPKAEHDYQYLEFETKPQISSNSNHVKQKSFT 107