BLASTX nr result
ID: Rehmannia29_contig00016715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00016715 (1401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087999.1| uncharacterized protein LOC105169319 [Sesamu... 61 4e-07 >ref|XP_011087999.1| uncharacterized protein LOC105169319 [Sesamum indicum] Length = 186 Score = 60.8 bits (146), Expect = 4e-07 Identities = 38/81 (46%), Positives = 45/81 (55%), Gaps = 28/81 (34%) Frame = +2 Query: 2 DEMLTIELGLQVK--NSDMVQREEALMKSRELLFTEV----------------------- 106 DE+L +ELG+++K NS VQR+EAL +SRELLFTEV Sbjct: 66 DELLAVELGIEIKKLNSHAVQRDEALKRSRELLFTEVCKFMGLKSDDLRKKWKRMNEEER 125 Query: 107 ---GKGFVAEGSAHFHRLSAR 160 KGFV E SAHFH LSAR Sbjct: 126 WALAKGFVTEWSAHFHPLSAR 146