BLASTX nr result
ID: Rehmannia29_contig00016634
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00016634 (563 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PON90777.1| PI31 proteasome regulator [Trema orientalis] 58 1e-06 gb|PON59939.1| PI31 proteasome regulator [Parasponia andersonii] 58 1e-06 gb|KZV45933.1| putative proteasome inhibitor [Dorcoceras hygrome... 57 3e-06 ref|XP_011094928.1| probable proteasome inhibitor [Sesamum indicum] 57 4e-06 ref|XP_024194564.1| probable proteasome inhibitor [Rosa chinensi... 56 5e-06 gb|EPS59826.1| hypothetical protein M569_14980, partial [Genlise... 54 6e-06 ref|XP_015897007.1| PREDICTED: probable proteasome inhibitor [Zi... 56 7e-06 >gb|PON90777.1| PI31 proteasome regulator [Trema orientalis] Length = 302 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = +3 Query: 243 GPQDPRFFGGRTEXXXXXXXXXXXXXARFDPYGPPGVPGFEP 368 GP DPRFFGG E ARFDPYGPPGVPGFEP Sbjct: 232 GPNDPRFFGGGGEPGFPGAQPGVPPGARFDPYGPPGVPGFEP 273 >gb|PON59939.1| PI31 proteasome regulator [Parasponia andersonii] Length = 302 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = +3 Query: 243 GPQDPRFFGGRTEXXXXXXXXXXXXXARFDPYGPPGVPGFEP 368 GP DPRFFGG E ARFDPYGPPGVPGFEP Sbjct: 232 GPNDPRFFGGGGEPGFPGAQPGVPPGARFDPYGPPGVPGFEP 273 >gb|KZV45933.1| putative proteasome inhibitor [Dorcoceras hygrometricum] Length = 303 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +3 Query: 243 GPQDPRFFGGRT-EXXXXXXXXXXXXXARFDPYGPPGVPGFEP 368 GP DPRFFGGR E ARFDPYGPPGVPGFEP Sbjct: 232 GPNDPRFFGGRVGEPGLPGGLQGVPPGARFDPYGPPGVPGFEP 274 >ref|XP_011094928.1| probable proteasome inhibitor [Sesamum indicum] Length = 300 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +3 Query: 243 GPQDPRFFGGRT-EXXXXXXXXXXXXXARFDPYGPPGVPGFEP 368 GP DPRFFGGR E ARFDPYGPPGVPGFEP Sbjct: 230 GPDDPRFFGGRIGEPGFHGGLPGVPPGARFDPYGPPGVPGFEP 272 >ref|XP_024194564.1| probable proteasome inhibitor [Rosa chinensis] gb|PRQ37812.1| putative PI31 proteasome regulator [Rosa chinensis] Length = 290 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +3 Query: 243 GPQDPRFFGGRTEXXXXXXXXXXXXXARFDPYGPPGVPGFEP 368 GP DPR+FGG E ARFDPYGPPGVPGFEP Sbjct: 221 GPNDPRWFGGIREPGFPGGQPGVPPGARFDPYGPPGVPGFEP 262 >gb|EPS59826.1| hypothetical protein M569_14980, partial [Genlisea aurea] Length = 120 Score = 53.5 bits (127), Expect = 6e-06 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +3 Query: 243 GPQDPRFFGGRTEXXXXXXXXXXXXX--ARFDPYGPPGVPGFEP 368 GP DPRFFGGR+ ARFDPYGPPGVPGFEP Sbjct: 47 GPGDPRFFGGRSGDIGPGGLPTGVVPPGARFDPYGPPGVPGFEP 90 >ref|XP_015897007.1| PREDICTED: probable proteasome inhibitor [Ziziphus jujuba] Length = 296 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +3 Query: 243 GPQDPRFFGGRTEXXXXXXXXXXXXXARFDPYGPPGVPGFEP 368 GP DPR+FGG E ARFDPYGPPGVPGFEP Sbjct: 225 GPHDPRWFGGVGEPGFSGGLPGVPPGARFDPYGPPGVPGFEP 266