BLASTX nr result
ID: Rehmannia29_contig00016626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00016626 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22804.1| hypothetical protein MIMGU_mgv1a025135mg, partial... 74 2e-14 ref|XP_004516042.1| PREDICTED: proteinase inhibitor PSI-1.2 [Cic... 67 1e-11 gb|POF05064.1| proteinase inhibitor psi-1.2 [Quercus suber] 67 1e-11 gb|POE82144.1| proteinase inhibitor psi-1.2 [Quercus suber] 67 1e-11 ref|XP_022852264.1| proteinase inhibitor PSI-1.2-like [Olea euro... 67 2e-11 gb|PRQ20453.1| putative proteinase inhibitor I20 [Rosa chinensis] 67 2e-11 gb|EPS62184.1| hypothetical protein M569_12608 [Genlisea aurea] 66 3e-11 gb|PRQ20440.1| putative proteinase inhibitor I20 [Rosa chinensis] 65 6e-11 gb|PRQ20443.1| putative proteinase inhibitor I20 [Rosa chinensis] 65 6e-11 gb|ONI35750.1| hypothetical protein PRUPE_1G552700 [Prunus persica] 65 8e-11 gb|PRQ20442.1| putative proteinase inhibitor I20 [Rosa chinensis] 65 1e-10 gb|PHT79171.1| hypothetical protein T459_17223 [Capsicum annuum] 64 2e-10 gb|PHT45666.1| hypothetical protein CQW23_14824 [Capsicum baccat... 64 3e-10 ref|XP_022875960.1| proteinase inhibitor PSI-1.2-like [Olea euro... 63 5e-10 gb|AFN85539.1| proteinase inhibitor type-2, partial [Olea europaea] 63 6e-10 emb|CDP20849.1| unnamed protein product [Coffea canephora] 63 7e-10 ref|XP_019237096.1| PREDICTED: proteinase inhibitor PSI-1.2 [Nic... 62 1e-09 ref|XP_009786451.1| PREDICTED: proteinase inhibitor PSI-1.2-like... 62 1e-09 emb|CDP10659.1| unnamed protein product [Coffea canephora] 62 1e-09 ref|XP_009609049.1| PREDICTED: proteinase inhibitor PSI-1.2-like... 62 1e-09 >gb|EYU22804.1| hypothetical protein MIMGU_mgv1a025135mg, partial [Erythranthe guttata] Length = 66 Score = 73.9 bits (180), Expect = 2e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 4 YMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 YMTCPSSGSQKL P CNCCLA+ GCK+Y + GTLICT T Sbjct: 28 YMTCPSSGSQKLEPVCNCCLAKTGCKLYRDNGTLICTAT 66 >ref|XP_004516042.1| PREDICTED: proteinase inhibitor PSI-1.2 [Cicer arietinum] Length = 79 Score = 67.4 bits (163), Expect = 1e-11 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 4 YMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 YMTCPSSG Q L+P CNCCLA GCKIY GTLICT + Sbjct: 41 YMTCPSSGDQHLSPPCNCCLASTGCKIYKADGTLICTAS 79 >gb|POF05064.1| proteinase inhibitor psi-1.2 [Quercus suber] Length = 80 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 4 YMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 YMTCPSSG+++LNP CNCCLA GC +Y GT ICTGT Sbjct: 42 YMTCPSSGNKQLNPPCNCCLAPKGCTVYHADGTAICTGT 80 >gb|POE82144.1| proteinase inhibitor psi-1.2 [Quercus suber] Length = 80 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 4 YMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 YMTCPSSG+++LNP CNCCLA GC +Y GT ICTGT Sbjct: 42 YMTCPSSGNKQLNPPCNCCLAPKGCTVYHADGTAICTGT 80 >ref|XP_022852264.1| proteinase inhibitor PSI-1.2-like [Olea europaea var. sylvestris] Length = 82 Score = 67.0 bits (162), Expect = 2e-11 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 4 YMTCPSSGSQKLNPAC-NCCLAQPGCKIYTNTGTLICTGT 120 YM CPSSG QKL+P+C NCC AQ GCK+Y + GTLICTGT Sbjct: 43 YMICPSSGPQKLHPSCTNCCRAQKGCKLYRSDGTLICTGT 82 >gb|PRQ20453.1| putative proteinase inhibitor I20 [Rosa chinensis] Length = 77 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLA-QPGCKIYTNTGTLICTGT 120 AYMTCPSSGS ++P+CNCCLA Q GCKIY + GTLICT T Sbjct: 37 AYMTCPSSGSTHISPSCNCCLAPQVGCKIYYSDGTLICTKT 77 >gb|EPS62184.1| hypothetical protein M569_12608 [Genlisea aurea] Length = 73 Score = 66.2 bits (160), Expect = 3e-11 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICT 114 AYMTCPS+G QKL PACNCCLA GCKIY G+LIC+ Sbjct: 34 AYMTCPSTGLQKLAPACNCCLAGSGCKIYAADGSLICS 71 >gb|PRQ20440.1| putative proteinase inhibitor I20 [Rosa chinensis] Length = 79 Score = 65.5 bits (158), Expect = 6e-11 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLA-QPGCKIYTNTGTLICTGT 120 AYMTCPSSGS L+P+CNCCLA + GCKIY + GT ICT T Sbjct: 39 AYMTCPSSGSTHLSPSCNCCLAPEVGCKIYNSDGTQICTST 79 >gb|PRQ20443.1| putative proteinase inhibitor I20 [Rosa chinensis] Length = 79 Score = 65.5 bits (158), Expect = 6e-11 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLA-QPGCKIYTNTGTLICTGT 120 AYMTCPSSGS L+P+CNCCLA + GCKIY + GT ICT T Sbjct: 39 AYMTCPSSGSTHLSPSCNCCLAPEVGCKIYNSDGTRICTST 79 >gb|ONI35750.1| hypothetical protein PRUPE_1G552700 [Prunus persica] Length = 79 Score = 65.1 bits (157), Expect = 8e-11 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 4 YMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 YMTCPSSG+ +L+P+CNCCLA GC +Y GT ICTGT Sbjct: 41 YMTCPSSGNTQLSPSCNCCLAPAGCTLYRADGTSICTGT 79 >gb|PRQ20442.1| putative proteinase inhibitor I20 [Rosa chinensis] Length = 83 Score = 64.7 bits (156), Expect = 1e-10 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLA-QPGCKIYTNTGTLICTGT 120 AYMTCPSSG++ L+P CNCCLA +PGC IY + GT +CT T Sbjct: 43 AYMTCPSSGNEHLSPLCNCCLASEPGCAIYLSDGTRLCTST 83 >gb|PHT79171.1| hypothetical protein T459_17223 [Capsicum annuum] Length = 57 Score = 63.5 bits (153), Expect = 2e-10 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 AYM CPSSG+QKL P CNCCLA GC +Y TLICT T Sbjct: 18 AYMMCPSSGTQKLAPTCNCCLAPQGCSLYYADRTLICTST 57 >gb|PHT45666.1| hypothetical protein CQW23_14824 [Capsicum baccatum] gb|PHU14932.1| hypothetical protein BC332_16137 [Capsicum chinense] Length = 81 Score = 63.5 bits (153), Expect = 3e-10 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 AYM CPSSG+QKL P CNCCLA GC +Y TLICT T Sbjct: 42 AYMMCPSSGTQKLAPTCNCCLAPQGCSLYYADRTLICTST 81 >ref|XP_022875960.1| proteinase inhibitor PSI-1.2-like [Olea europaea var. sylvestris] Length = 80 Score = 63.2 bits (152), Expect = 5e-10 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICT 114 AY TCP+SG +KL PACNCC Q GCK++ GTL+CT Sbjct: 41 AYTTCPASGDEKLTPACNCCFLQTGCKLFMADGTLLCT 78 >gb|AFN85539.1| proteinase inhibitor type-2, partial [Olea europaea] Length = 78 Score = 62.8 bits (151), Expect = 6e-10 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 4 YMTCPSSGSQKLNPAC-NCCLAQPGCKIYTNTGTLICT 114 YM CPSSG QKL+P+C NCC AQ GCK+Y + GTLICT Sbjct: 41 YMICPSSGPQKLHPSCTNCCRAQKGCKLYRSDGTLICT 78 >emb|CDP20849.1| unnamed protein product [Coffea canephora] Length = 79 Score = 62.8 bits (151), Expect = 7e-10 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 AYMTCP + +KL P CNCCLA+PGCK++ GT+ICT + Sbjct: 40 AYMTCPPAPYKKLGPVCNCCLAKPGCKLFRADGTVICTAS 79 >ref|XP_019237096.1| PREDICTED: proteinase inhibitor PSI-1.2 [Nicotiana attenuata] gb|OIT22661.1| proteinase inhibitor type-2 cevi57 [Nicotiana attenuata] Length = 84 Score = 62.4 bits (150), Expect = 1e-09 Identities = 25/41 (60%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPAC-NCCLAQPGCKIYTNTGTLICTGT 120 AYMTCPSSG ++++P C NCC A GCK++ G+LICTGT Sbjct: 42 AYMTCPSSGDEQISPVCVNCCTADEGCKLFRTDGSLICTGT 82 >ref|XP_009786451.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana sylvestris] ref|XP_009800915.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana sylvestris] ref|XP_016452748.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana tabacum] Length = 84 Score = 62.4 bits (150), Expect = 1e-09 Identities = 25/41 (60%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPAC-NCCLAQPGCKIYTNTGTLICTGT 120 AYMTCPSSG ++++P C NCC A GCK++ G+LICTGT Sbjct: 42 AYMTCPSSGDEQISPVCVNCCTADEGCKLFRTDGSLICTGT 82 >emb|CDP10659.1| unnamed protein product [Coffea canephora] Length = 80 Score = 62.0 bits (149), Expect = 1e-09 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPACNCCLAQPGCKIYTNTGTLICTGT 120 AYMTCP + +KL P CNCC+A+PGCK++ GT+ICT + Sbjct: 41 AYMTCPPAPYKKLGPVCNCCMAKPGCKLFRADGTVICTAS 80 >ref|XP_009609049.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana tomentosiformis] ref|XP_009609787.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana tomentosiformis] Length = 96 Score = 62.4 bits (150), Expect = 1e-09 Identities = 25/41 (60%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 1 AYMTCPSSGSQKLNPAC-NCCLAQPGCKIYTNTGTLICTGT 120 AYMTCPSSG ++++P C NCC A GCK++ G+LICTGT Sbjct: 54 AYMTCPSSGDEQISPVCVNCCTADEGCKLFRTDGSLICTGT 94