BLASTX nr result
ID: Rehmannia29_contig00016581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00016581 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022857248.1| uncharacterized protein LOC111378308 [Olea e... 100 3e-22 ref|XP_022878006.1| uncharacterized protein LOC111395991 [Olea e... 97 1e-20 ref|XP_022843290.1| uncharacterized protein LOC111366827 [Olea e... 93 1e-19 gb|KRH17667.1| hypothetical protein GLYMA_13G006400 [Glycine max] 87 5e-17 gb|KRH21000.1| hypothetical protein GLYMA_13G214000 [Glycine max] 86 5e-17 gb|KRH38396.1| hypothetical protein GLYMA_09G133500 [Glycine max] 86 1e-16 gb|KRH12253.1| hypothetical protein GLYMA_15G162400 [Glycine max] 86 1e-16 ref|XP_006576082.1| PREDICTED: uncharacterized protein LOC102659... 86 2e-16 gb|KRH07381.1| hypothetical protein GLYMA_16G084500 [Glycine max] 83 5e-16 ref|XP_014630541.1| PREDICTED: uncharacterized protein LOC106798... 82 1e-15 gb|KRH72196.1| hypothetical protein GLYMA_02G197500 [Glycine max] 81 2e-15 gb|KRH75691.1| hypothetical protein GLYMA_01G101700 [Glycine max] 81 4e-15 gb|KRH61704.1| hypothetical protein GLYMA_04G063300 [Glycine max] 79 2e-14 gb|KRH07666.1| hypothetical protein GLYMA_16G102800 [Glycine max] 78 4e-14 gb|KRH17706.1| hypothetical protein GLYMA_13G009200 [Glycine max] 77 1e-13 gb|KDP37580.1| hypothetical protein JCGZ_08271 [Jatropha curcas] 76 2e-13 gb|KRH71625.1| hypothetical protein GLYMA_02G159400 [Glycine max] 67 5e-10 gb|KRH38484.1| hypothetical protein GLYMA_09G138900 [Glycine max] 66 9e-10 ref|XP_006382571.1| hypothetical protein POPTR_0005s034102g, par... 64 3e-09 ref|XP_006378896.1| hypothetical protein POPTR_0009s00310g, part... 64 4e-09 >ref|XP_022857248.1| uncharacterized protein LOC111378308 [Olea europaea var. sylvestris] Length = 388 Score = 100 bits (249), Expect = 3e-22 Identities = 43/91 (47%), Positives = 63/91 (69%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E TWGY LVG F + PGK L +LC SWKV+ +YF GW++FKF+++ +R +V+ G Sbjct: 27 IENTWGYELVGYFASRFPGKVALLQLCDSWKVNYKYFVHSSGWLVFKFETDLERLSVLHG 86 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y V+G PL+ KV P++F F D ++ +PV Sbjct: 87 GPYFVYGRPLMLKVMPRYFDFDDKDVSTMPV 117 >ref|XP_022878006.1| uncharacterized protein LOC111395991 [Olea europaea var. sylvestris] Length = 489 Score = 97.1 bits (240), Expect = 1e-20 Identities = 41/91 (45%), Positives = 62/91 (68%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E +WGY LVG F + PGK L +C SWKV+ +YF GW++FKF+++ DR +V+ G Sbjct: 133 IENSWGYGLVGYFAGRFPGKVALLHMCDSWKVNYKYFVHSSGWLVFKFETDVDRLSVLHG 192 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G + V+G PL+ KV P++F F D ++ +PV Sbjct: 193 GPHLVYGRPLILKVMPRYFDFNDKDVSTMPV 223 >ref|XP_022843290.1| uncharacterized protein LOC111366827 [Olea europaea var. sylvestris] Length = 387 Score = 93.2 bits (230), Expect = 1e-19 Identities = 42/91 (46%), Positives = 58/91 (63%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 VE WG+ LVG + PGK L +LC+SWKV+ +Y GW++FKF++ DR V++G Sbjct: 64 VEDAWGFSLVGYVAGRFPGKTALLQLCNSWKVNYKYSVHTSGWLIFKFENAEDRLNVLEG 123 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 Y V G PL+ K+ P+FF F D EI VP+ Sbjct: 124 RPYFVFGRPLMLKIMPQFFEFDDKEISTVPI 154 >gb|KRH17667.1| hypothetical protein GLYMA_13G006400 [Glycine max] Length = 466 Score = 86.7 bits (213), Expect = 5e-17 Identities = 37/91 (40%), Positives = 54/91 (59%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L + C W V+ Y GW++F+FQ+E D V+ Sbjct: 193 LEEAWGHSLIGYVAGRFPGKKALMECCQKWGVNFSYSTHESGWLVFRFQNEEDMNQVISA 252 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL KV P FF FG++E+ +PV Sbjct: 253 GPYFIFQRPLLLKVMPPFFDFGNEELSKIPV 283 >gb|KRH21000.1| hypothetical protein GLYMA_13G214000 [Glycine max] Length = 352 Score = 85.9 bits (211), Expect = 5e-17 Identities = 38/91 (41%), Positives = 52/91 (57%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L C W V Y GW++FKF+SE D V+ Sbjct: 154 LEEAWGHSLIGYVAGRFPGKKALLDCCQKWGVKFSYSTHESGWLVFKFESEDDLNQVLSA 213 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL KV P FF FG++E+ +PV Sbjct: 214 GPYFIFQRPLLLKVMPTFFDFGNEELSKIPV 244 >gb|KRH38396.1| hypothetical protein GLYMA_09G133500 [Glycine max] Length = 480 Score = 85.9 bits (211), Expect = 1e-16 Identities = 38/91 (41%), Positives = 52/91 (57%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L C W V Y GW++FKF+SE D V+ Sbjct: 122 LEEAWGHSLIGYVAGRFPGKKALLDCCQKWGVKFSYSAHESGWLVFKFESEDDLNQVLSA 181 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL KV P FF FG++E+ +PV Sbjct: 182 GPYFIFQRPLLLKVMPAFFDFGNEELSKIPV 212 >gb|KRH12253.1| hypothetical protein GLYMA_15G162400 [Glycine max] Length = 653 Score = 85.9 bits (211), Expect = 1e-16 Identities = 38/91 (41%), Positives = 52/91 (57%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L C W V Y GW++FKF+SE D V+ Sbjct: 170 LEEAWGHSLIGYVAGRFPGKKALLDCCQKWGVKFSYSAHESGWLVFKFESEDDLNQVLSA 229 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL KV P FF FG++E+ +PV Sbjct: 230 GPYFIFQRPLLLKVMPTFFDFGNEELSKIPV 260 >ref|XP_006576082.1| PREDICTED: uncharacterized protein LOC102659506 [Glycine max] Length = 964 Score = 85.5 bits (210), Expect = 2e-16 Identities = 38/91 (41%), Positives = 52/91 (57%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L C W V Y GW++FKF+SE D V+ Sbjct: 172 LEEAWGHSLIGYVAGRFPGKKALLDCCKKWGVKFSYSAHESGWLVFKFESEDDLNQVLSA 231 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL KV P FF FG++E+ +PV Sbjct: 232 GPYFIFQRPLLLKVMPAFFDFGNEELSKIPV 262 >gb|KRH07381.1| hypothetical protein GLYMA_16G084500 [Glycine max] Length = 318 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/91 (39%), Positives = 51/91 (56%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L C W + Y GW++FKF+SE D V+ Sbjct: 84 LEEAWGHSLIGYVAGRFPGKKALLDCCQKWGIKFSYSAHESGWLVFKFESEDDLNQVLSA 143 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL K P FF FG++E+ +PV Sbjct: 144 GPYFIFQRPLLLKFIPAFFDFGNEELSKIPV 174 >ref|XP_014630541.1| PREDICTED: uncharacterized protein LOC106798467 [Glycine max] Length = 316 Score = 81.6 bits (200), Expect = 1e-15 Identities = 35/91 (38%), Positives = 51/91 (56%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L C W V + GW++FKF++E D V Sbjct: 22 LEEAWGHSLIGYMIGRFPGKKALLDCCQKWGVKFSFSAHESGWLVFKFEAEDDLNQVFSA 81 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL KV P FF FG++E+ +P+ Sbjct: 82 GPYFIFQRPLLLKVMPAFFDFGNEELSKIPI 112 >gb|KRH72196.1| hypothetical protein GLYMA_02G197500 [Glycine max] Length = 292 Score = 80.9 bits (198), Expect = 2e-15 Identities = 37/90 (41%), Positives = 50/90 (55%) Frame = +3 Query: 6 EKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKGG 185 E+ WG+ L+G + GKK L C WKV Y GW++FKF+SE D V+ G Sbjct: 133 EEAWGHSLIGYVAGRFLGKKVLLDCCQKWKVKFSYSAHESGWLVFKFESEDDLNQVLSAG 192 Query: 186 SYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 Y + PLL KV FF FG++E+ +PV Sbjct: 193 PYFIFQRPLLLKVMSAFFDFGNEELSKIPV 222 >gb|KRH75691.1| hypothetical protein GLYMA_01G101700 [Glycine max] Length = 379 Score = 80.9 bits (198), Expect = 4e-15 Identities = 37/91 (40%), Positives = 52/91 (57%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ G+ L+G + PGKK L C W V Y + GW++FKF+SE D V+ Sbjct: 151 LEEALGHSLIGYVAGRFPGKKALLDCCKKWGVKFSYSAHQSGWLVFKFESEDDLNQVLSA 210 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL KV P FF FG++E+ +PV Sbjct: 211 GPYFIFQRPLLLKVMPAFFDFGNEELSKIPV 241 >gb|KRH61704.1| hypothetical protein GLYMA_04G063300 [Glycine max] Length = 306 Score = 78.6 bits (192), Expect = 2e-14 Identities = 35/90 (38%), Positives = 51/90 (56%) Frame = +3 Query: 6 EKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKGG 185 ++ WG+ L+G + PGKK L C W V Y GW+++KF+SE D V+ G Sbjct: 158 DEAWGHNLIGYVAGRFPGKKVLLDCCQKWGVKFSYSAHESGWLMYKFESEDDLNQVLSVG 217 Query: 186 SYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 Y + PLL KV P FF FG++E++ + V Sbjct: 218 PYFIFQRPLLLKVMPTFFDFGNEELNKIHV 247 >gb|KRH07666.1| hypothetical protein GLYMA_16G102800 [Glycine max] Length = 334 Score = 77.8 bits (190), Expect = 4e-14 Identities = 36/91 (39%), Positives = 51/91 (56%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L W V Y G ++FKF+SE D V+ Sbjct: 170 LEEAWGHSLIGYVAGRFPGKKALLDCWQKWGVKFSYSSHESGLLVFKFESEDDLNQVLSA 229 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y + PLL KV+P FF FG++E+ +PV Sbjct: 230 GPYFIFQRPLLLKVKPTFFDFGNEELSKIPV 260 >gb|KRH17706.1| hypothetical protein GLYMA_13G009200 [Glycine max] Length = 511 Score = 77.0 bits (188), Expect = 1e-13 Identities = 36/91 (39%), Positives = 48/91 (52%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +EK WG+ L+G + PGKK L + C W V Y W+ FKF S D V+ Sbjct: 77 LEKAWGHSLIGYVAGRFPGKKALLECCQKWGVKFSYSTHESDWLAFKFDSGDDMNHVLSV 136 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G + PLL KV P FF FG++E+ +PV Sbjct: 137 GPNFIFQRPLLLKVMPSFFDFGNEELSKIPV 167 >gb|KDP37580.1| hypothetical protein JCGZ_08271 [Jatropha curcas] Length = 326 Score = 75.9 bits (185), Expect = 2e-13 Identities = 35/91 (38%), Positives = 52/91 (57%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 VEKTWG+ VG F + PG + + L SW V C+ P GW++F F++E +R ++ Sbjct: 142 VEKTWGWCAVGSFTGRFPGMRAVQSLVDSWGVPCKILPHHRGWIVFCFETEEERTSIFAS 201 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 G Y+++G L + P FTF DE VP+ Sbjct: 202 GPYTLYGKSLFLRELPYGFTFKHDEFMMVPI 232 >gb|KRH71625.1| hypothetical protein GLYMA_02G159400 [Glycine max] Length = 381 Score = 66.6 bits (161), Expect = 5e-10 Identities = 32/91 (35%), Positives = 46/91 (50%) Frame = +3 Query: 3 VEKTWGYFLVGKFPYQHPGKKPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKG 182 +E+ WG+ L+G + PGKK L+ C W V Y GW++FKF+SE D Sbjct: 170 LEEAWGHSLIGYVAGRFPGKKALWDCCQKWGVKFSYSAHESGWLVFKFESEDD------- 222 Query: 183 GSYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 L +V P FF FG++E+ +PV Sbjct: 223 ----------LNQVMPAFFDFGNEELSKIPV 243 >gb|KRH38484.1| hypothetical protein GLYMA_09G138900 [Glycine max] Length = 369 Score = 65.9 bits (159), Expect = 9e-10 Identities = 29/71 (40%), Positives = 39/71 (54%) Frame = +3 Query: 63 KPLFKLCHSWKVHCEYFPVRDGWMLFKFQSEHDRETVMKGGSYSVHGIPLLRKVRPKFFT 242 K L C W V + GW++FKF+SE D V+ G Y + PLL KV P FF Sbjct: 134 KALLDCCQKWGVKFSFSAHESGWLVFKFESEDDLNQVLSAGPYFIFQRPLLLKVMPAFFD 193 Query: 243 FGDDEIDNVPV 275 FG++E+ +PV Sbjct: 194 FGNEELSKIPV 204 >ref|XP_006382571.1| hypothetical protein POPTR_0005s034102g, partial [Populus trichocarpa] Length = 429 Score = 64.3 bits (155), Expect = 3e-09 Identities = 33/88 (37%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = +3 Query: 15 WGYFLVGKFPYQHPGKKPLFKLCHS-WKVHCEYFPVRDGWMLFKFQSEHDRETVMKGGSY 191 W + L+G + PG L +S WK + + GW++F F SE D V+ GG Y Sbjct: 102 WRFSLIGFIAGKFPGYTSLSSFINSSWKRNVHFSMHDSGWLIFNFDSEMDMLEVLNGGPY 161 Query: 192 SVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 SVHG L+ K+ P+FF F E+ +PV Sbjct: 162 SVHGRLLILKIMPEFFDFDTSEMLRMPV 189 >ref|XP_006378896.1| hypothetical protein POPTR_0009s00310g, partial [Populus trichocarpa] Length = 501 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 1/90 (1%) Frame = +3 Query: 9 KTWGYFLVGKFPYQHPGKKPLFKLCHS-WKVHCEYFPVRDGWMLFKFQSEHDRETVMKGG 185 + W VG + PG + L + S WK GW++++F SE D+ +V++GG Sbjct: 182 EVWNLCAVGYVSGKSPGYRALNGIISSVWKCEASLTVHASGWLIYRFSSEEDKSSVLRGG 241 Query: 186 SYSVHGIPLLRKVRPKFFTFGDDEIDNVPV 275 Y V+G PL+ K KFF F +E+ PV Sbjct: 242 PYLVYGRPLILKPMTKFFDFSSEEMTRAPV 271