BLASTX nr result
ID: Rehmannia29_contig00016324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00016324 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073429.1| putative F-box/LRR-repeat protein At5g41840 ... 82 6e-15 >ref|XP_011073429.1| putative F-box/LRR-repeat protein At5g41840 [Sesamum indicum] ref|XP_011073430.1| putative F-box/LRR-repeat protein At5g41840 [Sesamum indicum] ref|XP_020548459.1| putative F-box/LRR-repeat protein At5g41840 [Sesamum indicum] ref|XP_020548460.1| putative F-box/LRR-repeat protein At5g41840 [Sesamum indicum] Length = 407 Score = 81.6 bits (200), Expect = 6e-15 Identities = 51/100 (51%), Positives = 61/100 (61%), Gaps = 9/100 (9%) Frame = -2 Query: 482 NGHGFLQGSLETFKPFIIKTLEKKNF---------AKRLKSLQLARLDLDENFSQYPFES 330 NG L+G LE P LE N+ AK LK L++ARLDLDEN SQYP+ES Sbjct: 239 NGVNCLEGELELDAP----NLEYFNYGGFLATRFLAKTLKCLRIARLDLDENVSQYPYES 294 Query: 329 DIQAAELIKVCSDTEKLWLSEKLFSVSFYIRILHSFVNPL 210 D QAA+LIKVCSD EKLWLSE + + +LH +PL Sbjct: 295 DEQAAKLIKVCSDAEKLWLSENV------VIMLHHCPHPL 328