BLASTX nr result
ID: Rehmannia29_contig00016323
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00016323 (586 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856803.1| PREDICTED: cytochrome c-type biogenesis CcmH... 59 1e-07 ref|XP_022881591.1| cytochrome c-type biogenesis CcmH-like mitoc... 57 5e-07 ref|XP_022842658.1| cytochrome c-type biogenesis CcmH-like mitoc... 57 5e-07 ref|NP_001235607.1| uncharacterized protein LOC100306221 [Glycin... 57 6e-07 gb|PIN13689.1| hypothetical protein CDL12_13686 [Handroanthus im... 57 1e-06 ref|XP_009601369.1| PREDICTED: cytochrome c-type biogenesis CcmH... 56 1e-06 ref|XP_016480663.1| PREDICTED: cytochrome c-type biogenesis CcmH... 56 2e-06 ref|XP_006444153.1| cytochrome c-type biogenesis CcmH-like mitoc... 56 2e-06 gb|PHU24386.1| Cytochrome c-type biogenesis CcmH-like mitochondr... 55 3e-06 gb|PHT47075.1| Cytochrome c-type biogenesis CcmH-like mitochondr... 55 3e-06 ref|XP_022992426.1| cytochrome c-type biogenesis CcmH-like mitoc... 55 4e-06 ref|XP_016491484.1| PREDICTED: cytochrome c-type biogenesis CcmH... 53 4e-06 ref|XP_016562692.1| PREDICTED: cytochrome c-type biogenesis CcmH... 55 4e-06 ref|XP_010062495.1| PREDICTED: cytochrome c-type biogenesis CcmH... 55 4e-06 ref|XP_022953979.1| cytochrome c-type biogenesis CcmH-like mitoc... 55 5e-06 emb|CDO98486.1| unnamed protein product [Coffea canephora] 54 8e-06 >ref|XP_012856803.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Erythranthe guttata] gb|EYU21472.1| hypothetical protein MIMGU_mgv1a015503mg [Erythranthe guttata] Length = 156 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLLXXXXXXXXXSWWRKWLS 467 M LNLVRGV LTPKEKETMLDLL SWWRKWLS Sbjct: 117 MTLNLVRGVALTPKEKETMLDLLTPPPSRGASSWWRKWLS 156 >ref|XP_022881591.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] ref|XP_022881592.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] ref|XP_022881593.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] Length = 156 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLLXXXXXXXXXSWWRKWL 470 MALNLVRGVPLTP+EKETML++L WWR+WL Sbjct: 117 MALNLVRGVPLTPREKETMLEVLTPPPPEGASYWWRRWL 155 >ref|XP_022842658.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] ref|XP_022842659.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] ref|XP_022842660.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] ref|XP_022842661.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] ref|XP_022842662.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] ref|XP_022842663.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Olea europaea var. sylvestris] Length = 156 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLLXXXXXXXXXSWWRKWL 470 MALNLVRGVPLTP+EKETML++L WWR+WL Sbjct: 117 MALNLVRGVPLTPREKETMLEVLTPPPPEGASFWWRRWL 155 >ref|NP_001235607.1| uncharacterized protein LOC100306221 [Glycine max] ref|XP_014633811.1| PREDICTED: uncharacterized protein LOC100306221 isoform X1 [Glycine max] gb|ACU14301.1| unknown [Glycine max] gb|KHN47829.1| Cytochrome c-type biogenesis protein CcmH [Glycine soja] gb|KRH44338.1| hypothetical protein GLYMA_08G204400 [Glycine max] gb|KRH44339.1| hypothetical protein GLYMA_08G204400 [Glycine max] gb|KRH44340.1| hypothetical protein GLYMA_08G204400 [Glycine max] Length = 159 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL--XXXXXXXXXSWWRKWLSQ 464 MALNLVRGVPLTPKEKETMLD+L WWR+WL Q Sbjct: 117 MALNLVRGVPLTPKEKETMLDILTPPRSQGVRTPFWWRRWLGQ 159 >gb|PIN13689.1| hypothetical protein CDL12_13686 [Handroanthus impetiginosus] Length = 160 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL--XXXXXXXXXSWWRKWLSQ 464 MALNLVRGVPLTPKEKETMLD+L SWWR+W++Q Sbjct: 118 MALNLVRGVPLTPKEKETMLDILTPPPPSRGTSSSWWRRWVAQ 160 >ref|XP_009601369.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tomentosiformis] Length = 137 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL-XXXXXXXXXSWWRKWLSQ 464 MALNLVRGVPLTPKEKETML++L SWWR+WL Q Sbjct: 96 MALNLVRGVPLTPKEKETMLEVLTPPPGGTSSSSWWRRWLQQ 137 >ref|XP_016480663.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tabacum] ref|XP_016480664.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tabacum] ref|XP_016480665.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tabacum] Length = 158 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL-XXXXXXXXXSWWRKWLSQ 464 MALNLVRGVPLTPKEKETML++L SWWR+WL Q Sbjct: 117 MALNLVRGVPLTPKEKETMLEVLTPPPGGTSSSSWWRRWLQQ 158 >ref|XP_006444153.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Citrus clementina] ref|XP_006479786.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Citrus sinensis] ref|XP_006479787.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Citrus sinensis] ref|XP_024044823.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Citrus clementina] gb|ESR57393.1| hypothetical protein CICLE_v10022630mg [Citrus clementina] gb|KDO38414.1| hypothetical protein CISIN_1g031429mg [Citrus sinensis] gb|KDO38415.1| hypothetical protein CISIN_1g031429mg [Citrus sinensis] dbj|GAY40770.1| hypothetical protein CUMW_054480 [Citrus unshiu] Length = 159 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/43 (67%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL--XXXXXXXXXSWWRKWLSQ 464 MALNLVRGVPLTPKEKETMLDLL SWWR+W Q Sbjct: 117 MALNLVRGVPLTPKEKETMLDLLTPPPPQRPSPSSWWRRWRGQ 159 >gb|PHU24386.1| Cytochrome c-type biogenesis CcmH-like mitochondrial protein [Capsicum chinense] Length = 158 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL-XXXXXXXXXSWWRKWLSQ 464 MALNLVRG+PLTPKEKETML++L SWWR+WL Q Sbjct: 117 MALNLVRGIPLTPKEKETMLEVLTPPPGGTSSLSWWRRWLQQ 158 >gb|PHT47075.1| Cytochrome c-type biogenesis CcmH-like mitochondrial protein [Capsicum baccatum] Length = 164 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL-XXXXXXXXXSWWRKWLSQ 464 MALNLVRG+PLTPKEKETML++L SWWR+WL Q Sbjct: 123 MALNLVRGIPLTPKEKETMLEVLTPPPGGTSSLSWWRRWLQQ 164 >ref|XP_022992426.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X2 [Cucurbita maxima] Length = 134 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL-XXXXXXXXXSWWRKWLSQ 464 MALN+VRGVPLTP+EK+TMLDLL WWR+W SQ Sbjct: 93 MALNIVRGVPLTPREKQTMLDLLSPPPPQRAASLWWRRWRSQ 134 >ref|XP_016491484.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tabacum] Length = 76 Score = 53.1 bits (126), Expect = 4e-06 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL-XXXXXXXXXSWWRKWLSQ 464 MALNLVRGVPLTPKEKETML++L SWW KW Q Sbjct: 35 MALNLVRGVPLTPKEKETMLEVLTPPPGGTSSSSWWSKWFQQ 76 >ref|XP_016562692.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Capsicum annuum] ref|XP_016562693.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Capsicum annuum] gb|PHT88806.1| Cytochrome c-type biogenesis CcmH-like mitochondrial protein [Capsicum annuum] Length = 158 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/42 (61%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL-XXXXXXXXXSWWRKWLSQ 464 MALNL+RG+PLTPKEKETML++L SWWR+WL Q Sbjct: 117 MALNLIRGIPLTPKEKETMLEVLTPPPGGTSSLSWWRRWLQQ 158 >ref|XP_010062495.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Eucalyptus grandis] gb|KCW69635.1| hypothetical protein EUGRSUZ_F03043 [Eucalyptus grandis] Length = 159 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL--XXXXXXXXXSWWRKWLSQ 464 MALNLVRGVPLTP EKETMLDLL SWW++WL Q Sbjct: 117 MALNLVRGVPLTPNEKETMLDLLTPPPSPRGAPSSWWKRWLGQ 159 >ref|XP_022953979.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita moschata] ref|XP_022953980.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita moschata] ref|XP_022953981.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita moschata] ref|XP_022953983.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita moschata] ref|XP_022953984.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita moschata] ref|XP_022992421.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X1 [Cucurbita maxima] ref|XP_022992422.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X1 [Cucurbita maxima] ref|XP_022992423.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X1 [Cucurbita maxima] ref|XP_022992424.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X1 [Cucurbita maxima] ref|XP_022992425.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X1 [Cucurbita maxima] ref|XP_023549463.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita pepo subsp. pepo] ref|XP_023549464.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita pepo subsp. pepo] ref|XP_023549465.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita pepo subsp. pepo] ref|XP_023549466.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Cucurbita pepo subsp. pepo] Length = 158 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL-XXXXXXXXXSWWRKWLSQ 464 MALN+VRGVPLTP+EK+TMLDLL WWR+W SQ Sbjct: 117 MALNIVRGVPLTPREKQTMLDLLSPPPPQRAASLWWRRWRSQ 158 >emb|CDO98486.1| unnamed protein product [Coffea canephora] Length = 159 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/43 (60%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -1 Query: 586 MALNLVRGVPLTPKEKETMLDLL--XXXXXXXXXSWWRKWLSQ 464 MALNLVRGVPLTPKEKETMLD+L WWR+W+ + Sbjct: 117 MALNLVRGVPLTPKEKETMLDVLTPPPPEGITSSFWWRRWVGR 159