BLASTX nr result
ID: Rehmannia29_contig00016030
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00016030 (1019 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087682.1| uncharacterized protein LOC105169092 isoform... 64 6e-10 ref|XP_011087683.1| uncharacterized protein LOC105169092 isoform... 64 6e-10 ref|XP_012850462.1| PREDICTED: tRNA pseudouridine synthase-like ... 64 2e-09 gb|PHU10223.1| hypothetical protein BC332_22083 [Capsicum chinense] 64 3e-09 gb|PHT63633.1| hypothetical protein T459_32455 [Capsicum annuum] 64 3e-09 gb|PHT41564.1| hypothetical protein CQW23_20418 [Capsicum baccatum] 64 3e-09 ref|XP_016539004.1| PREDICTED: tRNA pseudouridine synthase A [Ca... 64 3e-09 ref|XP_021650278.1| uncharacterized protein LOC110642500 [Hevea ... 64 3e-09 ref|XP_018817819.1| PREDICTED: uncharacterized protein LOC108988... 64 3e-09 ref|XP_018817821.1| PREDICTED: uncharacterized protein LOC108988... 64 3e-09 ref|XP_018817823.1| PREDICTED: uncharacterized protein LOC108988... 64 3e-09 gb|PIN08069.1| putative pseudouridylate synthase [Handroanthus i... 62 3e-09 ref|XP_018817824.1| PREDICTED: uncharacterized protein LOC108988... 64 3e-09 ref|XP_022896992.1| uncharacterized protein LOC111410732 isoform... 62 7e-09 ref|XP_021617484.1| LOW QUALITY PROTEIN: uncharacterized protein... 63 7e-09 gb|OAY45008.1| hypothetical protein MANES_07G024000 [Manihot esc... 63 7e-09 ref|XP_022896993.1| uncharacterized protein LOC111410732 isoform... 62 7e-09 gb|PIA57762.1| hypothetical protein AQUCO_00600470v1 [Aquilegia ... 63 9e-09 emb|CDO97613.1| unnamed protein product [Coffea canephora] 62 9e-09 gb|PIA57763.1| hypothetical protein AQUCO_00600470v1 [Aquilegia ... 63 9e-09 >ref|XP_011087682.1| uncharacterized protein LOC105169092 isoform X1 [Sesamum indicum] Length = 380 Score = 63.9 bits (154), Expect(2) = 6e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDV+CVPSDFH+RYKAQERT Sbjct: 156 FLQKNEGDIMVIDVRCVPSDFHSRYKAQERT 186 Score = 29.3 bits (64), Expect(2) = 6e-10 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSGKEP Sbjct: 185 RTYFYRLLSGKEP 197 >ref|XP_011087683.1| uncharacterized protein LOC105169092 isoform X2 [Sesamum indicum] Length = 361 Score = 63.9 bits (154), Expect(2) = 6e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDV+CVPSDFH+RYKAQERT Sbjct: 137 FLQKNEGDIMVIDVRCVPSDFHSRYKAQERT 167 Score = 29.3 bits (64), Expect(2) = 6e-10 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSGKEP Sbjct: 166 RTYFYRLLSGKEP 178 >ref|XP_012850462.1| PREDICTED: tRNA pseudouridine synthase-like 1 [Erythranthe guttata] gb|EYU26478.1| hypothetical protein MIMGU_mgv1a018737mg [Erythranthe guttata] Length = 374 Score = 64.3 bits (155), Expect(2) = 2e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGDMMVIDV+CVP+DFH+RYKAQERT Sbjct: 151 FLQKNEGDMMVIDVKCVPADFHSRYKAQERT 181 Score = 26.9 bits (58), Expect(2) = 2e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 180 RTYFYRLLSGMEP 192 >gb|PHU10223.1| hypothetical protein BC332_22083 [Capsicum chinense] Length = 384 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDV+CVP+DFHARYKAQERT Sbjct: 148 FLQKNEGDIMVIDVRCVPADFHARYKAQERT 178 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 177 RTYFYRLLSGPEP 189 >gb|PHT63633.1| hypothetical protein T459_32455 [Capsicum annuum] Length = 384 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDV+CVP+DFHARYKAQERT Sbjct: 148 FLQKNEGDIMVIDVRCVPADFHARYKAQERT 178 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 177 RTYFYRLLSGPEP 189 >gb|PHT41564.1| hypothetical protein CQW23_20418 [Capsicum baccatum] Length = 384 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDV+CVP+DFHARYKAQERT Sbjct: 148 FLQKNEGDIMVIDVRCVPADFHARYKAQERT 178 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 177 RTYFYRLLSGPEP 189 >ref|XP_016539004.1| PREDICTED: tRNA pseudouridine synthase A [Capsicum annuum] Length = 384 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDV+CVP+DFHARYKAQERT Sbjct: 148 FLQKNEGDIMVIDVRCVPADFHARYKAQERT 178 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 177 RTYFYRLLSGPEP 189 >ref|XP_021650278.1| uncharacterized protein LOC110642500 [Hevea brasiliensis] Length = 372 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDVQCVP+DFHAR+KAQERT Sbjct: 146 FLQKNEGDIMVIDVQCVPADFHARFKAQERT 176 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 175 RTYFYRLLSGPEP 187 >ref|XP_018817819.1| PREDICTED: uncharacterized protein LOC108988892 isoform X1 [Juglans regia] Length = 369 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDVQCVP+DFHAR+KAQERT Sbjct: 140 FLQKNEGDIMVIDVQCVPADFHARFKAQERT 170 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 169 RTYFYRLLSGPEP 181 >ref|XP_018817821.1| PREDICTED: uncharacterized protein LOC108988892 isoform X3 [Juglans regia] Length = 357 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDVQCVP+DFHAR+KAQERT Sbjct: 140 FLQKNEGDIMVIDVQCVPADFHARFKAQERT 170 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 169 RTYFYRLLSGPEP 181 >ref|XP_018817823.1| PREDICTED: uncharacterized protein LOC108988892 isoform X5 [Juglans regia] Length = 350 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDVQCVP+DFHAR+KAQERT Sbjct: 121 FLQKNEGDIMVIDVQCVPADFHARFKAQERT 151 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 150 RTYFYRLLSGPEP 162 >gb|PIN08069.1| putative pseudouridylate synthase [Handroanthus impetiginosus] Length = 333 Score = 61.6 bits (148), Expect(2) = 3e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+ VIDV+CVP+DFHARYKAQERT Sbjct: 99 FLQKNEGDITVIDVRCVPADFHARYKAQERT 129 Score = 29.3 bits (64), Expect(2) = 3e-09 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSGKEP Sbjct: 128 RTYFYRLLSGKEP 140 >ref|XP_018817824.1| PREDICTED: uncharacterized protein LOC108988892 isoform X6 [Juglans regia] Length = 312 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDVQCVP+DFHAR+KAQERT Sbjct: 140 FLQKNEGDIMVIDVQCVPADFHARFKAQERT 170 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 169 RTYFYRLLSGPEP 181 >ref|XP_022896992.1| uncharacterized protein LOC111410732 isoform X1 [Olea europaea var. sylvestris] Length = 384 Score = 61.6 bits (148), Expect(2) = 7e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKN GDMMVIDV+CVP DFHARYKAQERT Sbjct: 152 FLQKNGGDMMVIDVRCVPFDFHARYKAQERT 182 Score = 28.1 bits (61), Expect(2) = 7e-09 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLL+GKEP Sbjct: 181 RTYFYRLLTGKEP 193 >ref|XP_021617484.1| LOW QUALITY PROTEIN: uncharacterized protein LOC110618616 [Manihot esculenta] Length = 374 Score = 62.8 bits (151), Expect(2) = 7e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDVQCVP DFHAR+KAQERT Sbjct: 148 FLQKNEGDIMVIDVQCVPVDFHARFKAQERT 178 Score = 26.9 bits (58), Expect(2) = 7e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 177 RTYFYRLLSGPEP 189 >gb|OAY45008.1| hypothetical protein MANES_07G024000 [Manihot esculenta] Length = 337 Score = 62.8 bits (151), Expect(2) = 7e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKNEGD+MVIDVQCVP DFHAR+KAQERT Sbjct: 111 FLQKNEGDIMVIDVQCVPVDFHARFKAQERT 141 Score = 26.9 bits (58), Expect(2) = 7e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 140 RTYFYRLLSGPEP 152 >ref|XP_022896993.1| uncharacterized protein LOC111410732 isoform X2 [Olea europaea var. sylvestris] Length = 335 Score = 61.6 bits (148), Expect(2) = 7e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 132 FLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 FLQKN GDMMVIDV+CVP DFHARYKAQERT Sbjct: 152 FLQKNGGDMMVIDVRCVPFDFHARYKAQERT 182 Score = 28.1 bits (61), Expect(2) = 7e-09 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLL+GKEP Sbjct: 181 RTYFYRLLTGKEP 193 >gb|PIA57762.1| hypothetical protein AQUCO_00600470v1 [Aquilegia coerulea] Length = 384 Score = 63.2 bits (152), Expect(2) = 9e-09 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -3 Query: 171 GLLKKLMIHVILVFLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 G+++K + H FLQKNEGD+ VIDV+CVPSDFHAR+KAQERT Sbjct: 146 GVVRKAVNH----FLQKNEGDITVIDVRCVPSDFHARFKAQERT 185 Score = 26.2 bits (56), Expect(2) = 9e-09 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRL+SG EP Sbjct: 184 RTYFYRLISGPEP 196 >emb|CDO97613.1| unnamed protein product [Coffea canephora] Length = 378 Score = 62.4 bits (150), Expect(2) = 9e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 168 LLKKLMIHVILVFLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 ++KK + H FLQKNEGD+MVIDVQ VPSDFH+RYKAQERT Sbjct: 143 VVKKAVNH----FLQKNEGDIMVIDVQSVPSDFHSRYKAQERT 181 Score = 26.9 bits (58), Expect(2) = 9e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRLLSG EP Sbjct: 180 RTYFYRLLSGPEP 192 >gb|PIA57763.1| hypothetical protein AQUCO_00600470v1 [Aquilegia coerulea] Length = 376 Score = 63.2 bits (152), Expect(2) = 9e-09 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -3 Query: 171 GLLKKLMIHVILVFLQKNEGDMMVIDVQCVPSDFHARYKAQERT 40 G+++K + H FLQKNEGD+ VIDV+CVPSDFHAR+KAQERT Sbjct: 146 GVVRKAVNH----FLQKNEGDITVIDVRCVPSDFHARFKAQERT 185 Score = 26.2 bits (56), Expect(2) = 9e-09 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 41 RRYFYRLLSGKEP 3 R YFYRL+SG EP Sbjct: 184 RTYFYRLISGPEP 196