BLASTX nr result
ID: Rehmannia29_contig00016000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00016000 (632 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN27094.1| Cytochrome P450 CYP2 subfamily [Handroanthus impe... 65 1e-08 gb|PIN14767.1| Cytochrome P450 CYP2 subfamily [Handroanthus impe... 62 1e-07 ref|XP_011069728.1| geraniol 8-hydroxylase-like [Sesamum indicum] 60 7e-07 ref|XP_011070677.1| cytochrome P450 76C4-like [Sesamum indicum] 58 3e-06 >gb|PIN27094.1| Cytochrome P450 CYP2 subfamily [Handroanthus impetiginosus] Length = 511 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = -2 Query: 625 VKSIDGIFDRIVQKRKTKMCGPMDLSEGRKDYLQILLELKEKEDSKMSISDRQFKALLL 449 V+S+D IFD ++ + K K+ G + SEG+KD+LQILLEL EK DS+MSI+ Q KALL+ Sbjct: 246 VESVDRIFDAVIDEYKRKLSGEIK-SEGKKDFLQILLELMEKRDSEMSITQTQLKALLM 303 >gb|PIN14767.1| Cytochrome P450 CYP2 subfamily [Handroanthus impetiginosus] Length = 511 Score = 62.0 bits (149), Expect = 1e-07 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = -2 Query: 625 VKSIDGIFDRIVQKRKTKMCGPMDLSEGRKDYLQILLELKEKEDSKMSISDRQFKALLL 449 V+S+D IFD ++ + K K+ G + SEG+KD+LQILLEL EK DS+MSI+ Q KALL+ Sbjct: 246 VESVDRIFDAVIDEYKPKLRGEIK-SEGKKDFLQILLELMEKGDSEMSITLTQLKALLM 303 >ref|XP_011069728.1| geraniol 8-hydroxylase-like [Sesamum indicum] Length = 493 Score = 59.7 bits (143), Expect = 7e-07 Identities = 33/59 (55%), Positives = 47/59 (79%) Frame = -2 Query: 625 VKSIDGIFDRIVQKRKTKMCGPMDLSEGRKDYLQILLELKEKEDSKMSISDRQFKALLL 449 ++S+D IF+ +V K + KM G + EG+K++LQ++LEL+EKEDS+MSIS RQ KALLL Sbjct: 229 MQSMDRIFEYVVAKCR-KMLGGIK-KEGKKNFLQVMLELQEKEDSEMSISPRQIKALLL 285 >ref|XP_011070677.1| cytochrome P450 76C4-like [Sesamum indicum] Length = 507 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/59 (49%), Positives = 44/59 (74%) Frame = -2 Query: 625 VKSIDGIFDRIVQKRKTKMCGPMDLSEGRKDYLQILLELKEKEDSKMSISDRQFKALLL 449 V+S+D IF+ I+ + + K+ G + EG+KD+LQ+LLEL E+EDS+MS+S Q KAL + Sbjct: 242 VQSLDRIFEDIIARYRKKLSGEIK-KEGKKDFLQVLLELNEREDSEMSMSLTQIKALFV 299