BLASTX nr result
ID: Rehmannia29_contig00015985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00015985 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO02521.1| predicted Rac-like GTPase ortholog, partial [Nic... 80 2e-16 gb|AAB87673.1| Rho-like GTP binding protein, partial [Arabidopsi... 80 4e-16 gb|PNT27396.1| hypothetical protein POPTR_007G061500v3 [Populus ... 80 4e-16 emb|CDP17200.1| unnamed protein product [Coffea canephora] 80 4e-16 gb|PNT36151.1| hypothetical protein POPTR_005G110700v3 [Populus ... 80 7e-16 gb|EYU38786.1| hypothetical protein MIMGU_mgv1a0191691mg, partia... 78 7e-16 gb|AQK67929.1| Rho-related protein from plants 9 [Zea mays] 79 8e-16 gb|KCW53194.1| hypothetical protein EUGRSUZ_J02468 [Eucalyptus g... 80 8e-16 gb|POE49670.1| rac-like gtp-binding protein rac1 [Quercus suber] 79 8e-16 ref|XP_022775443.1| rac-like GTP-binding protein RHO1 isoform X2... 80 9e-16 gb|KDO84914.1| hypothetical protein CISIN_1g029215mg [Citrus sin... 79 9e-16 ref|XP_019058975.1| PREDICTED: rac-like GTP-binding protein RHO1... 80 1e-15 gb|KRH61025.1| hypothetical protein GLYMA_04G023300 [Glycine max] 80 1e-15 ref|NP_001327974.1| RAC-like 3 [Arabidopsis thaliana] >gi|106372... 80 1e-15 gb|AQK76500.1| Rho-related protein from plants 4 [Zea mays] 79 1e-15 gb|ACN35358.1| unknown [Zea mays] >gi|1142712571|gb|AQK76495.1| ... 79 1e-15 gb|PIA55450.1| hypothetical protein AQUCO_00700028v1 [Aquilegia ... 79 1e-15 gb|KJB59750.1| hypothetical protein B456_009G269600 [Gossypium r... 80 1e-15 gb|KJB47673.1| hypothetical protein B456_008G036100 [Gossypium r... 80 1e-15 gb|KJB47672.1| hypothetical protein B456_008G036100 [Gossypium r... 80 1e-15 >dbj|BAO02521.1| predicted Rac-like GTPase ortholog, partial [Nicotiana alata] Length = 81 Score = 79.7 bits (195), Expect = 2e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|AAB87673.1| Rho-like GTP binding protein, partial [Arabidopsis thaliana] Length = 99 Score = 79.7 bits (195), Expect = 4e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|PNT27396.1| hypothetical protein POPTR_007G061500v3 [Populus trichocarpa] Length = 102 Score = 79.7 bits (195), Expect = 4e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >emb|CDP17200.1| unnamed protein product [Coffea canephora] Length = 108 Score = 79.7 bits (195), Expect = 4e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|PNT36151.1| hypothetical protein POPTR_005G110700v3 [Populus trichocarpa] Length = 125 Score = 79.7 bits (195), Expect = 7e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|EYU38786.1| hypothetical protein MIMGU_mgv1a0191691mg, partial [Erythranthe guttata] Length = 62 Score = 77.8 bits (190), Expect = 7e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSA+RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVP Sbjct: 1 MSATRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVP 37 >gb|AQK67929.1| Rho-related protein from plants 9 [Zea mays] Length = 102 Score = 79.0 bits (193), Expect = 8e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVP 37 >gb|KCW53194.1| hypothetical protein EUGRSUZ_J02468 [Eucalyptus grandis] Length = 129 Score = 79.7 bits (195), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|POE49670.1| rac-like gtp-binding protein rac1 [Quercus suber] Length = 103 Score = 79.0 bits (193), Expect = 8e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVP 37 >ref|XP_022775443.1| rac-like GTP-binding protein RHO1 isoform X2 [Durio zibethinus] Length = 134 Score = 79.7 bits (195), Expect = 9e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|KDO84914.1| hypothetical protein CISIN_1g029215mg [Citrus sinensis] Length = 110 Score = 79.0 bits (193), Expect = 9e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVP 37 >ref|XP_019058975.1| PREDICTED: rac-like GTP-binding protein RHO1 [Tarenaya hassleriana] Length = 141 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|KRH61025.1| hypothetical protein GLYMA_04G023300 [Glycine max] Length = 143 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >ref|NP_001327974.1| RAC-like 3 [Arabidopsis thaliana] ref|NP_001327973.1| RAC-like 3 [Arabidopsis thaliana] gb|ANM66047.1| RAC-like 3 [Arabidopsis thaliana] gb|ANM66048.1| RAC-like 3 [Arabidopsis thaliana] Length = 146 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|AQK76500.1| Rho-related protein from plants 4 [Zea mays] Length = 119 Score = 79.0 bits (193), Expect = 1e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVP 37 >gb|ACN35358.1| unknown [Zea mays] gb|AQK76495.1| Rho-related protein from plants 4 [Zea mays] gb|AQK76497.1| Rho-related protein from plants 4 [Zea mays] Length = 120 Score = 79.0 bits (193), Expect = 1e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVP 37 >gb|PIA55450.1| hypothetical protein AQUCO_00700028v1 [Aquilegia coerulea] Length = 122 Score = 79.0 bits (193), Expect = 1e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVP 37 >gb|KJB59750.1| hypothetical protein B456_009G269600 [Gossypium raimondii] Length = 153 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|KJB47673.1| hypothetical protein B456_008G036100 [Gossypium raimondii] Length = 153 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37 >gb|KJB47672.1| hypothetical protein B456_008G036100 [Gossypium raimondii] Length = 153 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 3 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVP 37