BLASTX nr result
ID: Rehmannia29_contig00015859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00015859 (575 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPE02834.1| hypothetical protein GOBAR_DD00147 [Gossypium bar... 55 5e-06 ref|XP_015868795.1| PREDICTED: uncharacterized protein LOC107406... 55 7e-06 >gb|PPE02834.1| hypothetical protein GOBAR_DD00147 [Gossypium barbadense] Length = 200 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 3 VDPLKSLASNISFGTEVEVQLGKRLQVVSTFPKIIFLT 116 VDPLKSLASNISFGTEVEVQLGKRLQV + +I + Sbjct: 149 VDPLKSLASNISFGTEVEVQLGKRLQVNNILSSLIIFS 186 >ref|XP_015868795.1| PREDICTED: uncharacterized protein LOC107406205 [Ziziphus jujuba] Length = 242 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 VDPLKSLASNISFGTEVEVQLGKRLQVV 86 VDPLKSLASNISFGTEVEVQLGKRLQV+ Sbjct: 201 VDPLKSLASNISFGTEVEVQLGKRLQVI 228