BLASTX nr result
ID: Rehmannia29_contig00015812
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00015812 (820 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020550478.1| pentatricopeptide repeat-containing protein ... 60 2e-06 ref|XP_011081936.1| pentatricopeptide repeat-containing protein ... 60 2e-06 >ref|XP_020550478.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial isoform X2 [Sesamum indicum] Length = 821 Score = 60.1 bits (144), Expect = 2e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 820 MLDRGLAPDDATYDILVSGKFKESISPQGALSV 722 MLDRGLAPDD TYDILVSGKFKE+ SP GALSV Sbjct: 789 MLDRGLAPDDTTYDILVSGKFKENSSPLGALSV 821 >ref|XP_011081936.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial isoform X1 [Sesamum indicum] ref|XP_011081937.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial isoform X1 [Sesamum indicum] ref|XP_011081938.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial isoform X1 [Sesamum indicum] ref|XP_011081939.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial isoform X1 [Sesamum indicum] Length = 859 Score = 60.1 bits (144), Expect = 2e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 820 MLDRGLAPDDATYDILVSGKFKESISPQGALSV 722 MLDRGLAPDD TYDILVSGKFKE+ SP GALSV Sbjct: 827 MLDRGLAPDDTTYDILVSGKFKENSSPLGALSV 859