BLASTX nr result
ID: Rehmannia29_contig00015759
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00015759 (771 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ANI70192.1| auxin response factor ARF20 [Salvia miltiorrhiza] 79 8e-13 gb|PKI76045.1| hypothetical protein CRG98_003595, partial [Punic... 73 8e-13 ref|XP_011093873.1| auxin response factor 19 isoform X1 [Sesamum... 78 1e-12 ref|XP_014508657.1| auxin response factor 19 isoform X4 [Vigna r... 77 2e-12 ref|XP_014508656.1| auxin response factor 19 isoform X2 [Vigna r... 77 2e-12 gb|POE57673.1| auxin response factor 19 [Quercus suber] 76 3e-12 dbj|GAV76243.1| AUX_IAA domain-containing protein/B3 domain-cont... 77 3e-12 gb|KOM47659.1| hypothetical protein LR48_Vigan07g136300 [Vigna a... 77 4e-12 ref|XP_017428692.1| PREDICTED: auxin response factor 19 [Vigna a... 77 4e-12 ref|XP_020994043.1| auxin response factor 19 [Arachis duranensis] 77 4e-12 ref|XP_016189155.1| auxin response factor 19 isoform X3 [Arachis... 77 4e-12 ref|XP_020974576.1| auxin response factor 19 isoform X1 [Arachis... 77 4e-12 ref|XP_023895176.1| auxin response factor 19-like [Quercus suber] 76 4e-12 gb|EYU28308.1| hypothetical protein MIMGU_mgv1a001526mg [Erythra... 76 7e-12 ref|XP_012848075.1| PREDICTED: LOW QUALITY PROTEIN: auxin respon... 76 7e-12 ref|XP_022842521.1| auxin response factor 19-like [Olea europaea... 76 7e-12 ref|XP_011648572.1| PREDICTED: auxin response factor 19 isoform ... 75 9e-12 ref|NP_001292622.1| auxin response factor 19 [Cucumis sativus] >... 75 1e-11 ref|XP_011648570.1| PREDICTED: auxin response factor 19 isoform ... 75 1e-11 ref|XP_008460042.1| PREDICTED: auxin response factor 19 isoform ... 75 1e-11 >gb|ANI70192.1| auxin response factor ARF20 [Salvia miltiorrhiza] Length = 786 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+PSNGFL NS EGEKKVINSELWHACAGPLVSLPPV Sbjct: 1 MKVPSNGFLANSAEGEKKVINSELWHACAGPLVSLPPV 38 >gb|PKI76045.1| hypothetical protein CRG98_003595, partial [Punica granatum] Length = 103 Score = 72.8 bits (177), Expect = 8e-13 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+PSNGF +GEGEKK INSELWHACAGPLVSLPPV Sbjct: 1 MKVPSNGFSPGAGEGEKKTINSELWHACAGPLVSLPPV 38 >ref|XP_011093873.1| auxin response factor 19 isoform X1 [Sesamum indicum] Length = 1078 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+PSNGFL NSGEGEKKVINSELWHACAGPLV LPPV Sbjct: 1 MKMPSNGFLANSGEGEKKVINSELWHACAGPLVCLPPV 38 >ref|XP_014508657.1| auxin response factor 19 isoform X4 [Vigna radiata var. radiata] Length = 1144 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+PSNGFL NSGEGE+K INSELWHACAGPLVSLPPV Sbjct: 1 MKVPSNGFLPNSGEGERKTINSELWHACAGPLVSLPPV 38 >ref|XP_014508656.1| auxin response factor 19 isoform X2 [Vigna radiata var. radiata] Length = 1150 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+PSNGFL NSGEGE+K INSELWHACAGPLVSLPPV Sbjct: 1 MKVPSNGFLPNSGEGERKTINSELWHACAGPLVSLPPV 38 >gb|POE57673.1| auxin response factor 19 [Quercus suber] Length = 355 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+P NGFL NSGEGEKK INSELWHACAGPLVSLPPV Sbjct: 1 MKVPQNGFLPNSGEGEKKSINSELWHACAGPLVSLPPV 38 >dbj|GAV76243.1| AUX_IAA domain-containing protein/B3 domain-containing protein/Auxin_resp domain-containing protein [Cephalotus follicularis] Length = 1132 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK PSNGFL NS EGEKKVINSELWHACAGPLVSLPPV Sbjct: 1 MKAPSNGFLANSAEGEKKVINSELWHACAGPLVSLPPV 38 >gb|KOM47659.1| hypothetical protein LR48_Vigan07g136300 [Vigna angularis] Length = 953 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+PSNGFL NSGEGE+K INSELWHACAGPLVSLPPV Sbjct: 1 MKVPSNGFLPNSGEGERKPINSELWHACAGPLVSLPPV 38 >ref|XP_017428692.1| PREDICTED: auxin response factor 19 [Vigna angularis] Length = 1111 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+PSNGFL NSGEGE+K INSELWHACAGPLVSLPPV Sbjct: 1 MKVPSNGFLPNSGEGERKPINSELWHACAGPLVSLPPV 38 >ref|XP_020994043.1| auxin response factor 19 [Arachis duranensis] Length = 1123 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK PSNGFL NSGEGEKK INSELWHACAGPLVSLPP+ Sbjct: 1 MKAPSNGFLPNSGEGEKKTINSELWHACAGPLVSLPPI 38 >ref|XP_016189155.1| auxin response factor 19 isoform X3 [Arachis ipaensis] Length = 1130 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK PSNGFL NSGEGEKK INSELWHACAGPLVSLPP+ Sbjct: 1 MKAPSNGFLPNSGEGEKKTINSELWHACAGPLVSLPPI 38 >ref|XP_020974576.1| auxin response factor 19 isoform X1 [Arachis ipaensis] Length = 1137 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK PSNGFL NSGEGEKK INSELWHACAGPLVSLPP+ Sbjct: 1 MKAPSNGFLPNSGEGEKKTINSELWHACAGPLVSLPPI 38 >ref|XP_023895176.1| auxin response factor 19-like [Quercus suber] Length = 537 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK+P NGFL NSGEGEKK INSELWHACAGPLVSLPPV Sbjct: 1 MKVPQNGFLPNSGEGEKKSINSELWHACAGPLVSLPPV 38 >gb|EYU28308.1| hypothetical protein MIMGU_mgv1a001526mg [Erythranthe guttata] Length = 803 Score = 75.9 bits (185), Expect = 7e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MKIPSNGF+ +GEGEKK+INSELWHACAGPLVSLPPV Sbjct: 1 MKIPSNGFMATAGEGEKKLINSELWHACAGPLVSLPPV 38 >ref|XP_012848075.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 19-like [Erythranthe guttata] Length = 1037 Score = 75.9 bits (185), Expect = 7e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MKIPSNGF+ +GEGEKK+INSELWHACAGPLVSLPPV Sbjct: 1 MKIPSNGFMATAGEGEKKLINSELWHACAGPLVSLPPV 38 >ref|XP_022842521.1| auxin response factor 19-like [Olea europaea var. sylvestris] Length = 1042 Score = 75.9 bits (185), Expect = 7e-12 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 641 VNFAAMKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 ++FA MK+PSNG++ N+GEG + VINSELWHACAGPLVSLPPV Sbjct: 1 MSFAKMKVPSNGYMANTGEGGENVINSELWHACAGPLVSLPPV 43 >ref|XP_011648572.1| PREDICTED: auxin response factor 19 isoform X2 [Cucumis sativus] Length = 944 Score = 75.5 bits (184), Expect = 9e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK PSNGFL NSGEGE+K INSELWHACAGPLVSLPPV Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSLPPV 38 >ref|NP_001292622.1| auxin response factor 19 [Cucumis sativus] dbj|BAD19061.1| auxin response factor 1 [Cucumis sativus] Length = 1081 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK PSNGFL NSGEGE+K INSELWHACAGPLVSLPPV Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSLPPV 38 >ref|XP_011648570.1| PREDICTED: auxin response factor 19 isoform X1 [Cucumis sativus] ref|XP_011648571.1| PREDICTED: auxin response factor 19 isoform X1 [Cucumis sativus] gb|KGN60494.1| hypothetical protein Csa_2G000030 [Cucumis sativus] Length = 1097 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK PSNGFL NSGEGE+K INSELWHACAGPLVSLPPV Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSLPPV 38 >ref|XP_008460042.1| PREDICTED: auxin response factor 19 isoform X2 [Cucumis melo] Length = 1102 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 656 MKIPSNGFLGNSGEGEKKVINSELWHACAGPLVSLPPV 769 MK PSNGFL NSGEGE+K INSELWHACAGPLVSLPPV Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSLPPV 38