BLASTX nr result
ID: Rehmannia29_contig00015325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00015325 (735 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085104.1| uncharacterized protein LOC105167185 isoform... 64 7e-08 >ref|XP_011085104.1| uncharacterized protein LOC105167185 isoform X5 [Sesamum indicum] ref|XP_020550950.1| uncharacterized protein LOC105167185 isoform X5 [Sesamum indicum] Length = 587 Score = 63.5 bits (153), Expect = 7e-08 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 338 PMHFPHGLCECI*IEY*QVRLDVATILGLLAFLFSYKFEDILSSPYVLVCS 490 P+ FPH ++ VRLDVATILGLLA+ FSYKFEDILSSPYVL+C+ Sbjct: 513 PVVFPHKKLSFRILD--TVRLDVATILGLLAYFFSYKFEDILSSPYVLICN 561