BLASTX nr result
ID: Rehmannia29_contig00014923
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00014923 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN02798.1| hypothetical protein CDL12_24688 [Handroanthus im... 59 1e-07 >gb|PIN02798.1| hypothetical protein CDL12_24688 [Handroanthus impetiginosus] Length = 203 Score = 58.5 bits (140), Expect = 1e-07 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 4/67 (5%) Frame = +3 Query: 12 KPKDAEGEDKSKQKAETEATKPKLKDGGEEKKVHNHRSTPN----EEISIPALPNILNGK 179 K KD + K K K E+E K KLKDGGE KK P EE S PALP I+NGK Sbjct: 137 KQKDEVEDQKPKLKKESEENKAKLKDGGEGKKPAATPQQPTLPQIEEPSFPALPGIINGK 196 Query: 180 TVETTLP 200 T ET P Sbjct: 197 TAETIFP 203