BLASTX nr result
ID: Rehmannia29_contig00014865
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00014865 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN22376.1| Proline synthetase co-transcribed protein [Handro... 201 2e-61 emb|CDP04433.1| unnamed protein product [Coffea canephora] 199 2e-61 ref|XP_011087040.1| proline synthase co-transcribed bacterial ho... 199 3e-61 ref|XP_012841976.1| PREDICTED: proline synthase co-transcribed b... 198 1e-60 ref|XP_021819680.1| pyridoxal phosphate homeostasis protein [Pru... 197 2e-60 ref|XP_008224704.1| PREDICTED: proline synthase co-transcribed b... 197 2e-60 gb|KZV16140.1| Pyridoxal phosphate-dependent enzyme [Dorcoceras ... 197 4e-60 gb|OMO64778.1| hypothetical protein COLO4_31816 [Corchorus olito... 196 5e-60 gb|PHU26770.1| Proline synthase co-transcribed bacterial -like p... 196 1e-59 ref|XP_009795210.1| PREDICTED: proline synthase co-transcribed b... 196 2e-59 gb|PHT56360.1| Proline synthase co-transcribed bacterial -like p... 196 2e-59 ref|XP_019251662.1| PREDICTED: proline synthase co-transcribed b... 196 2e-59 gb|PPD96416.1| hypothetical protein GOBAR_DD06579 [Gossypium bar... 195 2e-59 ref|XP_016693269.1| PREDICTED: proline synthase co-transcribed b... 195 2e-59 ref|XP_012451716.1| PREDICTED: proline synthase co-transcribed b... 195 2e-59 ref|XP_016560155.1| PREDICTED: proline synthase co-transcribed b... 195 4e-59 ref|XP_017643748.1| PREDICTED: proline synthase co-transcribed b... 194 7e-59 ref|XP_008384095.2| PREDICTED: LOW QUALITY PROTEIN: proline synt... 194 7e-59 ref|XP_009614449.1| PREDICTED: proline synthase co-transcribed b... 194 8e-59 ref|XP_023892009.1| pyridoxal phosphate homeostasis protein-like... 193 8e-59 >gb|PIN22376.1| Proline synthetase co-transcribed protein [Handroanthus impetiginosus] Length = 277 Score = 201 bits (510), Expect = 2e-61 Identities = 95/101 (94%), Positives = 98/101 (97%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVELAKHVS+NCPNLEFCGLMTIGMPDYTSTPENFKTLANCR+EVCKALG+ Sbjct: 175 KSGVEPAGCVELAKHVSINCPNLEFCGLMTIGMPDYTSTPENFKTLANCRSEVCKALGMP 234 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 303 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ Sbjct: 235 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 275 >emb|CDP04433.1| unnamed protein product [Coffea canephora] Length = 246 Score = 199 bits (507), Expect = 2e-61 Identities = 93/103 (90%), Positives = 99/103 (96%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 KYGVEP GCVEL KHV++ CPNLEFCGLMTIGM DYTSTPENFKTLA+CRTEVCKALGI+ Sbjct: 144 KYGVEPAGCVELVKHVTLRCPNLEFCGLMTIGMADYTSTPENFKTLADCRTEVCKALGIT 203 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPK+Q+N Sbjct: 204 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKRQSN 246 >ref|XP_011087040.1| proline synthase co-transcribed bacterial homolog protein, partial [Sesamum indicum] Length = 245 Score = 199 bits (506), Expect = 3e-61 Identities = 93/101 (92%), Positives = 98/101 (97%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCV+L KH+SMNCPNLEFCGLMTIGMPDYTSTPENFKTLA+CR+EVCKALGI+ Sbjct: 145 KSGVEPAGCVDLVKHISMNCPNLEFCGLMTIGMPDYTSTPENFKTLASCRSEVCKALGIA 204 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 303 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ Sbjct: 205 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 245 >ref|XP_012841976.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Erythranthe guttata] gb|EYU33880.1| hypothetical protein MIMGU_mgv1a011838mg [Erythranthe guttata] Length = 269 Score = 198 bits (504), Expect = 1e-60 Identities = 93/100 (93%), Positives = 96/100 (96%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 KYGVEP G VELAKHV NCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGI+ Sbjct: 170 KYGVEPSGVVELAKHVRTNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIA 229 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 300 EEQCELSMGMSGDFELA+EMGSTNVR+GSTIFGAREYPKK Sbjct: 230 EEQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPKK 269 >ref|XP_021819680.1| pyridoxal phosphate homeostasis protein [Prunus avium] Length = 246 Score = 197 bits (500), Expect = 2e-60 Identities = 94/103 (91%), Positives = 97/103 (94%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVELAKHVS+ CPNLEFCGLMTIGM DYTSTPENFKTLANCRTEVCKALGI Sbjct: 144 KSGVEPSGCVELAKHVSLGCPNLEFCGLMTIGMLDYTSTPENFKTLANCRTEVCKALGIP 203 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 EEQCELSMGMS DFELAIE+GSTNVRIGSTIFGAREYPKKQ+N Sbjct: 204 EEQCELSMGMSADFELAIELGSTNVRIGSTIFGAREYPKKQSN 246 >ref|XP_008224704.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Prunus mume] Length = 246 Score = 197 bits (500), Expect = 2e-60 Identities = 94/103 (91%), Positives = 97/103 (94%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVELAKHVS+ CPNLEFCGLMTIGM DYTSTPENFKTLANCRTEVCKALGI Sbjct: 144 KSGVEPSGCVELAKHVSLGCPNLEFCGLMTIGMLDYTSTPENFKTLANCRTEVCKALGIP 203 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 EEQCELSMGMS DFELAIE+GSTNVRIGSTIFGAREYPKKQ+N Sbjct: 204 EEQCELSMGMSADFELAIELGSTNVRIGSTIFGAREYPKKQSN 246 >gb|KZV16140.1| Pyridoxal phosphate-dependent enzyme [Dorcoceras hygrometricum] Length = 274 Score = 197 bits (501), Expect = 4e-60 Identities = 92/99 (92%), Positives = 97/99 (97%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVELAKHVS+NCPNLEFCGLMTIGMPDYTSTPENFKTLANCR+EVCKALGI+ Sbjct: 176 KSGVEPAGCVELAKHVSLNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRSEVCKALGIA 235 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPK 297 E+QCELSMGMSGDFE+AIEMGSTNVRIGSTIFGAREYPK Sbjct: 236 EDQCELSMGMSGDFEMAIEMGSTNVRIGSTIFGAREYPK 274 >gb|OMO64778.1| hypothetical protein COLO4_31816 [Corchorus olitorius] Length = 245 Score = 196 bits (498), Expect = 5e-60 Identities = 92/100 (92%), Positives = 97/100 (97%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVELA+HV+++CPNLEFCGLMTIGMPDYTSTPENFKTLANCR+EVCKALGI Sbjct: 145 KSGVEPSGCVELARHVALSCPNLEFCGLMTIGMPDYTSTPENFKTLANCRSEVCKALGIP 204 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 300 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK Sbjct: 205 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 244 >gb|PHU26770.1| Proline synthase co-transcribed bacterial -like protein [Capsicum chinense] Length = 279 Score = 196 bits (498), Expect = 1e-59 Identities = 91/103 (88%), Positives = 98/103 (95%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVEL K+V+ NCPNLEFCGLMTIGMPDYTSTPENFKTLA CR+EVCKALGIS Sbjct: 177 KSGVEPDGCVELVKYVASNCPNLEFCGLMTIGMPDYTSTPENFKTLAKCRSEVCKALGIS 236 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 E+QCELSMGMSGDFELA+EMGSTNVR+GSTIFGAREYPKKQ+N Sbjct: 237 EDQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPKKQSN 279 >ref|XP_009795210.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Nicotiana sylvestris] ref|XP_016435569.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Nicotiana tabacum] Length = 277 Score = 196 bits (497), Expect = 2e-59 Identities = 91/103 (88%), Positives = 97/103 (94%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GC+EL KHV+ NCPNLEFCGLMTIGMPDYTSTPENFKTLA CR+EVCKAL IS Sbjct: 175 KSGVEPDGCLELVKHVTSNCPNLEFCGLMTIGMPDYTSTPENFKTLARCRSEVCKALEIS 234 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 E+QCELSMGMSGDFELA+EMGSTNVR+GSTIFGAREYPKKQTN Sbjct: 235 EDQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPKKQTN 277 >gb|PHT56360.1| Proline synthase co-transcribed bacterial -like protein [Capsicum baccatum] Length = 279 Score = 196 bits (497), Expect = 2e-59 Identities = 90/103 (87%), Positives = 98/103 (95%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVEL K+++ NCPNLEFCGLMTIGMPDYTSTPENFKTLA CR+EVCKALGIS Sbjct: 177 KSGVEPDGCVELVKYIASNCPNLEFCGLMTIGMPDYTSTPENFKTLAKCRSEVCKALGIS 236 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 E+QCELSMGMSGDFELA+EMGSTNVR+GSTIFGAREYPKKQ+N Sbjct: 237 EDQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPKKQSN 279 >ref|XP_019251662.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Nicotiana attenuata] Length = 279 Score = 196 bits (497), Expect = 2e-59 Identities = 91/103 (88%), Positives = 97/103 (94%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GC+EL KHV+ NCPNLEFCGLMTIGMPDYTSTPENFKTLA CR+EVCKAL IS Sbjct: 177 KSGVEPDGCLELVKHVTSNCPNLEFCGLMTIGMPDYTSTPENFKTLARCRSEVCKALEIS 236 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 E+QCELSMGMSGDFELA+EMGSTNVR+GSTIFGAREYPKKQTN Sbjct: 237 EDQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPKKQTN 279 >gb|PPD96416.1| hypothetical protein GOBAR_DD06579 [Gossypium barbadense] Length = 264 Score = 195 bits (495), Expect = 2e-59 Identities = 91/100 (91%), Positives = 95/100 (95%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVEL KHVS+NCPNL+FCGLMTIGMPDYTSTPENFKTLANCR+EVCKALGI Sbjct: 164 KSGVEPSGCVELVKHVSLNCPNLQFCGLMTIGMPDYTSTPENFKTLANCRSEVCKALGIP 223 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 300 EEQCELSMGMS DFELAIEMGSTNVR+GSTIFGAREYPKK Sbjct: 224 EEQCELSMGMSSDFELAIEMGSTNVRVGSTIFGAREYPKK 263 >ref|XP_016693269.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Gossypium hirsutum] Length = 264 Score = 195 bits (495), Expect = 2e-59 Identities = 91/100 (91%), Positives = 95/100 (95%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVEL KHVS+NCPNL+FCGLMTIGMPDYTSTPENFKTLANCR+EVCKALGI Sbjct: 164 KSGVEPSGCVELVKHVSLNCPNLQFCGLMTIGMPDYTSTPENFKTLANCRSEVCKALGIP 223 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 300 EEQCELSMGMS DFELAIEMGSTNVR+GSTIFGAREYPKK Sbjct: 224 EEQCELSMGMSSDFELAIEMGSTNVRVGSTIFGAREYPKK 263 >ref|XP_012451716.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Gossypium raimondii] gb|KJB67262.1| hypothetical protein B456_010G182800 [Gossypium raimondii] Length = 264 Score = 195 bits (495), Expect = 2e-59 Identities = 91/100 (91%), Positives = 95/100 (95%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVEL KHVS+NCPNL+FCGLMTIGMPDYTSTPENFKTLANCR+EVCKALGI Sbjct: 164 KSGVEPSGCVELVKHVSLNCPNLQFCGLMTIGMPDYTSTPENFKTLANCRSEVCKALGIP 223 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 300 EEQCELSMGMS DFELAIEMGSTNVR+GSTIFGAREYPKK Sbjct: 224 EEQCELSMGMSSDFELAIEMGSTNVRVGSTIFGAREYPKK 263 >ref|XP_016560155.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Capsicum annuum] gb|PHT90803.1| Proline synthase co-transcribed bacterial -like protein [Capsicum annuum] Length = 279 Score = 195 bits (495), Expect = 4e-59 Identities = 90/103 (87%), Positives = 98/103 (95%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVEL K+V+ NCPNLEFCGLMTIGMPDYTSTPENFKTLA CR+EVCKALGIS Sbjct: 177 KSGVEPDGCVELVKYVASNCPNLEFCGLMTIGMPDYTSTPENFKTLAKCRSEVCKALGIS 236 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 E+QCELSMGMSGDFELA+EMGSTNVR+GSTIFGAREYPK+Q+N Sbjct: 237 EDQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPKRQSN 279 >ref|XP_017643748.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Gossypium arboreum] Length = 264 Score = 194 bits (492), Expect = 7e-59 Identities = 90/101 (89%), Positives = 95/101 (94%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVEL KHVS+NCPNL+FCGLMTIGMPDYTSTPENFKTLANCR+EVCK LGI Sbjct: 164 KSGVEPSGCVELVKHVSLNCPNLQFCGLMTIGMPDYTSTPENFKTLANCRSEVCKVLGIP 223 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 303 EEQCELSMGMS DFELAIEMGSTNVR+GSTIFGAREYPKK+ Sbjct: 224 EEQCELSMGMSSDFELAIEMGSTNVRVGSTIFGAREYPKKK 264 >ref|XP_008384095.2| PREDICTED: LOW QUALITY PROTEIN: proline synthase co-transcribed bacterial homolog protein-like [Malus domestica] Length = 267 Score = 194 bits (492), Expect = 7e-59 Identities = 93/103 (90%), Positives = 95/103 (92%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GCVELAKHV+ CPNLEFCGLMTIGM DYTSTPENFKTLANCRTEVCK LGI Sbjct: 165 KSGVEPSGCVELAKHVTSGCPNLEFCGLMTIGMLDYTSTPENFKTLANCRTEVCKELGIP 224 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 EEQCELSMGMS DFELAIEMGSTNVRIGSTIFGAREYPKKQ+N Sbjct: 225 EEQCELSMGMSSDFELAIEMGSTNVRIGSTIFGAREYPKKQSN 267 >ref|XP_009614449.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Nicotiana tomentosiformis] Length = 279 Score = 194 bits (493), Expect = 8e-59 Identities = 90/103 (87%), Positives = 97/103 (94%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K GVEP GC+EL KHV+ NCPNLEFCGLMTIGMPDYTSTP+NFKTLA CR+EVCKAL IS Sbjct: 177 KSGVEPEGCLELVKHVTSNCPNLEFCGLMTIGMPDYTSTPDNFKTLARCRSEVCKALEIS 236 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 E+QCELSMGMSGDFELA+EMGSTNVR+GSTIFGAREYPKKQTN Sbjct: 237 EDQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPKKQTN 279 >ref|XP_023892009.1| pyridoxal phosphate homeostasis protein-like [Quercus suber] gb|POE61331.1| proline synthase co-transcribed bacterial like protein [Quercus suber] Length = 248 Score = 193 bits (490), Expect = 8e-59 Identities = 91/103 (88%), Positives = 96/103 (93%) Frame = +1 Query: 1 KYGVEPGGCVELAKHVSMNCPNLEFCGLMTIGMPDYTSTPENFKTLANCRTEVCKALGIS 180 K+GVEP GCVELAKHVS+ CPNLEFCGLMTIGM DY+STPENFK L+NCRTEVCKALGI Sbjct: 146 KFGVEPSGCVELAKHVSLGCPNLEFCGLMTIGMLDYSSTPENFKALSNCRTEVCKALGIP 205 Query: 181 EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 309 EEQCELSMGMS DFE AIEMGSTNVRIGSTIFGAREYPKKQ+N Sbjct: 206 EEQCELSMGMSADFEQAIEMGSTNVRIGSTIFGAREYPKKQSN 248