BLASTX nr result
ID: Rehmannia29_contig00014683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00014683 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088663.1| rop guanine nucleotide exchange factor 1 [Se... 82 3e-15 ref|XP_012837225.1| PREDICTED: rop guanine nucleotide exchange f... 80 2e-14 gb|PIN25717.1| hypothetical protein CDL12_01511 [Handroanthus im... 78 7e-14 gb|KZV20836.1| rop guanine nucleotide exchange factor 1-like [Do... 68 3e-10 ref|XP_002528427.1| PREDICTED: rop guanine nucleotide exchange f... 60 1e-07 emb|CDP15789.1| unnamed protein product [Coffea canephora] 59 5e-07 emb|CAN75129.1| hypothetical protein VITISV_042431 [Vitis vinifera] 55 2e-06 ref|XP_023903248.1| rop guanine nucleotide exchange factor 1 iso... 56 3e-06 gb|POF20312.1| rop guanine nucleotide exchange factor 1 [Quercus... 56 3e-06 ref|XP_006364517.1| PREDICTED: rop guanine nucleotide exchange f... 56 4e-06 dbj|GAV86609.1| PRONE domain-containing protein, partial [Cephal... 55 6e-06 ref|XP_021610681.1| rop guanine nucleotide exchange factor 1 [Ma... 55 8e-06 ref|XP_015059996.1| PREDICTED: rop guanine nucleotide exchange f... 55 8e-06 ref|XP_004231073.1| PREDICTED: rop guanine nucleotide exchange f... 55 8e-06 ref|XP_002282312.1| PREDICTED: rop guanine nucleotide exchange f... 55 8e-06 >ref|XP_011088663.1| rop guanine nucleotide exchange factor 1 [Sesamum indicum] Length = 565 Score = 82.0 bits (201), Expect = 3e-15 Identities = 38/48 (79%), Positives = 43/48 (89%), Gaps = 2/48 (4%) Frame = +1 Query: 37 VTPLNKS--TRLTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 VTPLNKS T + NHK+DK++PADLDKLWSYAGNLGSRR+ GDAPERD Sbjct: 518 VTPLNKSGLTGVPNHKFDKVMPADLDKLWSYAGNLGSRRIPGDAPERD 565 >ref|XP_012837225.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Erythranthe guttata] ref|XP_012837226.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Erythranthe guttata] gb|EYU38000.1| hypothetical protein MIMGU_mgv1a003780mg [Erythranthe guttata] Length = 564 Score = 79.7 bits (195), Expect = 2e-14 Identities = 38/47 (80%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = +1 Query: 37 VTPLNKSTRLTN-HKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 VTPLNKSTR+ N +K+DK+VPADLDKLWSYAGNLGSRRV G+A ERD Sbjct: 518 VTPLNKSTRMPNVNKFDKVVPADLDKLWSYAGNLGSRRVPGEAQERD 564 >gb|PIN25717.1| hypothetical protein CDL12_01511 [Handroanthus impetiginosus] Length = 565 Score = 78.2 bits (191), Expect = 7e-14 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 2/48 (4%) Frame = +1 Query: 37 VTPLNKS--TRLTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 VTPLNKS T + NHK D++VP DL+KLWSY GNLGSRRVSGDAPERD Sbjct: 518 VTPLNKSGLTGVPNHKLDRVVPTDLEKLWSYTGNLGSRRVSGDAPERD 565 >gb|KZV20836.1| rop guanine nucleotide exchange factor 1-like [Dorcoceras hygrometricum] Length = 566 Score = 67.8 bits (164), Expect = 3e-10 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +1 Query: 37 VTPLNKSTR--LTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 V+P +KS NHK+DK+VPADLDKLWSYAGNL SR V GDAPER+ Sbjct: 519 VSPHSKSGLPVFPNHKFDKVVPADLDKLWSYAGNLSSRSVHGDAPERN 566 >ref|XP_002528427.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Ricinus communis] gb|EEF33969.1| Rop guanine nucleotide exchange factor, putative [Ricinus communis] Length = 580 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +1 Query: 46 LNKSTRLTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 +N T+ K++K PAD +K+WSY GNL SRRVSGDAPERD Sbjct: 538 MNNIKEATDQKFEKPCPADFEKVWSYTGNLSSRRVSGDAPERD 580 >emb|CDP15789.1| unnamed protein product [Coffea canephora] Length = 577 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 70 NHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 N K DK++PADLDKLWSYAG+L +RR+S + PERD Sbjct: 543 NRKIDKVIPADLDKLWSYAGSLSARRISENVPERD 577 >emb|CAN75129.1| hypothetical protein VITISV_042431 [Vitis vinifera] Length = 162 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +1 Query: 46 LNKSTRLTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 L K K +K +PAD +K+WSY GNL +R+VSGDAPERD Sbjct: 120 LEKPIPAPEMKLEKPIPADFEKMWSYTGNLSARKVSGDAPERD 162 >ref|XP_023903248.1| rop guanine nucleotide exchange factor 1 isoform X1 [Quercus suber] ref|XP_023903255.1| rop guanine nucleotide exchange factor 1 isoform X2 [Quercus suber] Length = 578 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 88 IVPADLDKLWSYAGNLGSRRVSGDAPERD 174 +VP D DK+WSYAGNL SRRVSGDAPERD Sbjct: 550 VVPTDYDKVWSYAGNLSSRRVSGDAPERD 578 >gb|POF20312.1| rop guanine nucleotide exchange factor 1 [Quercus suber] Length = 783 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 88 IVPADLDKLWSYAGNLGSRRVSGDAPERD 174 +VP D DK+WSYAGNL SRRVSGDAPERD Sbjct: 755 VVPTDYDKVWSYAGNLSSRRVSGDAPERD 783 >ref|XP_006364517.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Solanum tuberosum] Length = 577 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 64 LTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 L K +K+ P DLDKLWSYAGNL +RR S DAPERD Sbjct: 541 LPTAKLEKVTPTDLDKLWSYAGNLSARRPSKDAPERD 577 >dbj|GAV86609.1| PRONE domain-containing protein, partial [Cephalotus follicularis] Length = 622 Score = 55.5 bits (132), Expect = 6e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +1 Query: 94 PADLDKLWSYAGNLGSRRVSGDAPERD 174 PAD +K+WSYAGNLGSRR+SGDAPERD Sbjct: 596 PADFEKMWSYAGNLGSRRLSGDAPERD 622 >ref|XP_021610681.1| rop guanine nucleotide exchange factor 1 [Manihot esculenta] gb|OAY52252.1| hypothetical protein MANES_04G068900 [Manihot esculenta] Length = 571 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = +1 Query: 49 NKSTRLTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 N + ++ K +K PA+ +K+WSY GNL +RRVSGDAPERD Sbjct: 530 NNAKEASDQKLEKPCPAEFEKVWSYTGNLSARRVSGDAPERD 571 >ref|XP_015059996.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Solanum pennellii] Length = 577 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 64 LTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 L K +K+ P DLDKLWSYAGNL +RR S DAPERD Sbjct: 541 LPTAKLEKVSPTDLDKLWSYAGNLSARRPSKDAPERD 577 >ref|XP_004231073.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Solanum lycopersicum] Length = 577 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 64 LTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 L K +K+ P DLDKLWSYAGNL +RR S DAPERD Sbjct: 541 LPTAKLEKVSPTDLDKLWSYAGNLSARRPSKDAPERD 577 >ref|XP_002282312.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Vitis vinifera] ref|XP_010645975.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Vitis vinifera] ref|XP_010645982.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Vitis vinifera] emb|CBI37759.3| unnamed protein product, partial [Vitis vinifera] Length = 587 Score = 55.1 bits (131), Expect = 8e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +1 Query: 46 LNKSTRLTNHKYDKIVPADLDKLWSYAGNLGSRRVSGDAPERD 174 L K K +K +PAD +K+WSY GNL +R+VSGDAPERD Sbjct: 545 LEKPIPAPEMKLEKPIPADFEKMWSYTGNLSARKVSGDAPERD 587