BLASTX nr result
ID: Rehmannia29_contig00014639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00014639 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012454365.1| PREDICTED: alkaline ceramidase 3-like [Gossy... 54 7e-06 gb|ESR34207.1| hypothetical protein CICLE_v10005697mg [Citrus cl... 53 1e-05 >ref|XP_012454365.1| PREDICTED: alkaline ceramidase 3-like [Gossypium raimondii] gb|KJB72054.1| hypothetical protein B456_011G156200 [Gossypium raimondii] Length = 255 Score = 54.3 bits (129), Expect = 7e-06 Identities = 28/50 (56%), Positives = 32/50 (64%) Frame = +1 Query: 271 IHAIIM*CAIGDFV*TFTFENCFGYFLRQQQGDETPMVWEMLLYIYILYS 420 +H M AIG + T + C +QQQGDETPMVWEMLLY YILYS Sbjct: 63 LHVSNMILAIGSMLYHATLQQC-----KQQQGDETPMVWEMLLYFYILYS 107 >gb|ESR34207.1| hypothetical protein CICLE_v10005697mg [Citrus clementina] Length = 190 Score = 53.1 bits (126), Expect = 1e-05 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +1 Query: 349 LRQQQGDETPMVWEMLLYIYILYS 420 +RQQQGDETPMVWEMLLYIYILYS Sbjct: 19 IRQQQGDETPMVWEMLLYIYILYS 42