BLASTX nr result
ID: Rehmannia29_contig00014625
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00014625 (586 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085076.1| potassium transporter 4-like [Sesamum indicum] 56 9e-06 >ref|XP_011085076.1| potassium transporter 4-like [Sesamum indicum] Length = 819 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = +2 Query: 425 MSQIQIDTEEDSNDLPPPVVAGGGQESTHTSEQDGQDEHARIASNTRNL 571 M+Q I EE+SNDLPPP G +EST + QDGQ+EHA+I R L Sbjct: 1 MNQPDIAVEEESNDLPPPTAVGEAEESTRAAGQDGQNEHAQIEGKKRTL 49