BLASTX nr result
ID: Rehmannia29_contig00014377
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00014377 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08526.1| Anaphase-promoting complex (APC), subunit 11 [Han... 76 2e-13 ref|XP_011077262.1| uncharacterized protein LOC105161315 [Sesamu... 76 3e-13 ref|XP_012834753.1| PREDICTED: uncharacterized protein LOC105955... 73 2e-12 ref|XP_022863644.1| uncharacterized protein LOC111383735 [Olea e... 68 2e-10 gb|KZV37384.1| hypothetical protein F511_01252 [Dorcoceras hygro... 66 8e-10 ref|XP_022879236.1| uncharacterized protein LOC111396876 isoform... 65 1e-09 ref|XP_022890094.1| uncharacterized protein LOC111405440 [Olea e... 64 4e-09 >gb|PIN08526.1| Anaphase-promoting complex (APC), subunit 11 [Handroanthus impetiginosus] Length = 728 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 291 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPPS 404 MGSKWRKVKLA GLNLCVYGP+N VADNDDDEDS+PP+ Sbjct: 1 MGSKWRKVKLALGLNLCVYGPRNHVADNDDDEDSMPPA 38 >ref|XP_011077262.1| uncharacterized protein LOC105161315 [Sesamum indicum] Length = 722 Score = 75.9 bits (185), Expect = 3e-13 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = +3 Query: 291 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPPS 404 MGSKWRKVKLA GLNLCVYGP N V DNDDDEDSLPPS Sbjct: 1 MGSKWRKVKLALGLNLCVYGPNNHVVDNDDDEDSLPPS 38 >ref|XP_012834753.1| PREDICTED: uncharacterized protein LOC105955551 [Erythranthe guttata] Length = 694 Score = 73.2 bits (178), Expect = 2e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 291 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPP 401 MGSKWRKVKLA G+NLCVYGP+N VADNDDD DSLPP Sbjct: 1 MGSKWRKVKLALGMNLCVYGPRNHVADNDDDYDSLPP 37 >ref|XP_022863644.1| uncharacterized protein LOC111383735 [Olea europaea var. sylvestris] Length = 722 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 291 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPPS 404 MGSKWRKVKLA GLNLCVY P+N +ADND+++ SLPPS Sbjct: 1 MGSKWRKVKLALGLNLCVYTPRNNIADNDEEDGSLPPS 38 >gb|KZV37384.1| hypothetical protein F511_01252 [Dorcoceras hygrometricum] Length = 722 Score = 65.9 bits (159), Expect = 8e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 291 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPPS 404 MGS+WRKVKLA GLN+CVY +N VADNDDDED PPS Sbjct: 1 MGSRWRKVKLALGLNMCVYSSRNHVADNDDDEDYPPPS 38 >ref|XP_022879236.1| uncharacterized protein LOC111396876 isoform X1 [Olea europaea var. sylvestris] ref|XP_022879237.1| uncharacterized protein LOC111396876 isoform X2 [Olea europaea var. sylvestris] Length = 722 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 291 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPPS 404 MGSKWRKVKLA G+NLCVY P+N +ADNDD++ SL PS Sbjct: 1 MGSKWRKVKLALGMNLCVYTPRNNIADNDDEDGSLSPS 38 >ref|XP_022890094.1| uncharacterized protein LOC111405440 [Olea europaea var. sylvestris] Length = 702 Score = 63.9 bits (154), Expect = 4e-09 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 291 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPPS 404 MGSKW +VKLA G+NLC+Y P+N DNDD++DSLPP+ Sbjct: 1 MGSKWNRVKLALGMNLCIYTPRNQTLDNDDEDDSLPPA 38