BLASTX nr result
ID: Rehmannia29_contig00013753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00013753 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18775.1| putative Zn-finger protein [Handroanthus impetigi... 131 8e-36 gb|PIN14387.1| putative Zn-finger protein [Handroanthus impetigi... 130 2e-35 ref|XP_012849801.1| PREDICTED: zinc finger A20 and AN1 domain-co... 129 3e-35 ref|XP_011093526.1| zinc finger A20 and AN1 domain-containing st... 129 6e-35 ref|XP_012844705.1| PREDICTED: zinc finger A20 and AN1 domain-co... 127 2e-34 gb|OWM78363.1| hypothetical protein CDL15_Pgr016087 [Punica gran... 127 2e-34 ref|XP_011087429.1| zinc finger A20 and AN1 domain-containing st... 125 8e-34 gb|ACM68451.1| stress-associated protein 1, partial [Solanum pen... 123 8e-34 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] >gi|... 123 8e-34 gb|KZV50293.1| stress-associated protein 1 [Dorcoceras hygrometr... 125 9e-34 emb|CDP07749.1| unnamed protein product [Coffea canephora] 125 1e-33 ref|XP_022896572.1| zinc finger A20 and AN1 domain-containing st... 125 1e-33 ref|XP_019260445.1| PREDICTED: zinc finger A20 and AN1 domain-co... 125 1e-33 ref|XP_009783307.1| PREDICTED: zinc finger A20 and AN1 domain-co... 125 1e-33 gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum] 124 2e-33 ref|XP_010106958.1| zinc finger A20 and AN1 domain-containing st... 125 2e-33 gb|ATW75720.1| stress-associated protein 1 [Solanum tuberosum] 125 2e-33 gb|ATW75722.1| stress-associated protein 1 [Solanum tuberosum] 125 2e-33 ref|XP_019158911.1| PREDICTED: zinc finger A20 and AN1 domain-co... 124 3e-33 ref|XP_009591907.1| PREDICTED: zinc finger A20 and AN1 domain-co... 124 3e-33 >gb|PIN18775.1| putative Zn-finger protein [Handroanthus impetiginosus] Length = 178 Score = 131 bits (329), Expect = 8e-36 Identities = 58/63 (92%), Positives = 59/63 (93%) Frame = -3 Query: 263 PEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGREAIMR 84 PE A PV+REVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDC YDYKSAGREAI R Sbjct: 106 PEDAPPVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCRYDYKSAGREAIAR 165 Query: 83 ENP 75 ENP Sbjct: 166 ENP 168 >gb|PIN14387.1| putative Zn-finger protein [Handroanthus impetiginosus] Length = 177 Score = 130 bits (326), Expect = 2e-35 Identities = 57/62 (91%), Positives = 59/62 (95%) Frame = -3 Query: 260 EAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGREAIMRE 81 EA+ P RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK+AGREAI RE Sbjct: 106 EASPPARREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIARE 165 Query: 80 NP 75 NP Sbjct: 166 NP 167 >ref|XP_012849801.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata] Length = 178 Score = 129 bits (325), Expect = 3e-35 Identities = 57/62 (91%), Positives = 60/62 (96%) Frame = -3 Query: 260 EAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGREAIMRE 81 EAA P++REVNRCSGCRRKVGLTGFRCRCG+LFCADHRYSDRHDCSYDYKSAGREAI RE Sbjct: 107 EAALPLKREVNRCSGCRRKVGLTGFRCRCGDLFCADHRYSDRHDCSYDYKSAGREAIERE 166 Query: 80 NP 75 NP Sbjct: 167 NP 168 >ref|XP_011093526.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Sesamum indicum] Length = 177 Score = 129 bits (323), Expect = 6e-35 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = -3 Query: 260 EAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGREAIMRE 81 + A PV+REVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK+AGREAI RE Sbjct: 106 DVAPPVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIARE 165 Query: 80 NP 75 NP Sbjct: 166 NP 167 >ref|XP_012844705.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata] Length = 179 Score = 127 bits (320), Expect = 2e-34 Identities = 55/62 (88%), Positives = 59/62 (95%) Frame = -3 Query: 260 EAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGREAIMRE 81 +AA P +REVNRC+GCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK+AGREAI RE Sbjct: 108 DAAPPAKREVNRCTGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIARE 167 Query: 80 NP 75 NP Sbjct: 168 NP 169 >gb|OWM78363.1| hypothetical protein CDL15_Pgr016087 [Punica granatum] gb|PKI31656.1| hypothetical protein CRG98_047940 [Punica granatum] Length = 181 Score = 127 bits (320), Expect = 2e-34 Identities = 56/63 (88%), Positives = 57/63 (90%) Frame = -3 Query: 263 PEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGREAIMR 84 PE RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK+AGREAI R Sbjct: 109 PETESTARREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKAAGREAIAR 168 Query: 83 ENP 75 ENP Sbjct: 169 ENP 171 >ref|XP_011087429.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Sesamum indicum] Length = 170 Score = 125 bits (315), Expect = 8e-34 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -3 Query: 254 AQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGREAIMRENP 75 A PV+R+VNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK+AGR+AI RENP Sbjct: 101 APPVKRQVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKAAGRQAIARENP 160 >gb|ACM68451.1| stress-associated protein 1, partial [Solanum pennellii] Length = 87 Score = 123 bits (308), Expect = 8e-34 Identities = 53/67 (79%), Positives = 58/67 (86%) Frame = -3 Query: 275 EEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGRE 96 E+ + P +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYK+AGRE Sbjct: 11 EDQLKASLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGRE 70 Query: 95 AIMRENP 75 AI RENP Sbjct: 71 AIARENP 77 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] gb|PHT59116.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum baccatum] gb|PHU30166.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum chinense] Length = 88 Score = 123 bits (308), Expect = 8e-34 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = -3 Query: 275 EEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGRE 96 ++ ++ P +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYK+AGRE Sbjct: 12 DDQLKDSLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGRE 71 Query: 95 AIMRENP 75 AI RENP Sbjct: 72 AIARENP 78 >gb|KZV50293.1| stress-associated protein 1 [Dorcoceras hygrometricum] Length = 175 Score = 125 bits (315), Expect = 9e-34 Identities = 57/80 (71%), Positives = 62/80 (77%) Frame = -3 Query: 314 GEELESTCDEWGSEEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR 135 G T + +E A PV+REVNRCSGCRRKVGLTGFRCRCGEL CADHRYSDR Sbjct: 86 GSNPAETTGDLKTEASTEAALPPVKREVNRCSGCRRKVGLTGFRCRCGELLCADHRYSDR 145 Query: 134 HDCSYDYKSAGREAIMRENP 75 HDCSYDYK+AGREAI +ENP Sbjct: 146 HDCSYDYKAAGREAIAKENP 165 >emb|CDP07749.1| unnamed protein product [Coffea canephora] Length = 189 Score = 125 bits (315), Expect = 1e-33 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 263 PEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGREAIMR 84 P A V+REVNRCSGCRRKVGLTGFRCRCGELFCA+HRYSDRHDCSYDYK+AGREAI R Sbjct: 117 PATAAAVKREVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIAR 176 Query: 83 ENP 75 ENP Sbjct: 177 ENP 179 >ref|XP_022896572.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Olea europaea var. sylvestris] Length = 165 Score = 125 bits (313), Expect = 1e-33 Identities = 59/83 (71%), Positives = 68/83 (81%), Gaps = 2/83 (2%) Frame = -3 Query: 317 PGEELESTCDEWGSEEXXPEAAQPV--RREVNRCSGCRRKVGLTGFRCRCGELFCADHRY 144 P +L+S G ++ ++A+ V +REVNRCSGCRRKVGLTGFRCRCGELFCADHRY Sbjct: 73 PERKLKSVEISKGLKKDDSDSAEVVLVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRY 132 Query: 143 SDRHDCSYDYKSAGREAIMRENP 75 SDRHDCSYDYK+AGREAI RENP Sbjct: 133 SDRHDCSYDYKAAGREAISRENP 155 >ref|XP_019260445.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Nicotiana attenuata] gb|OIT39162.1| zinc finger a20 and an1 domain-containing stress-associated protein 5 [Nicotiana attenuata] Length = 180 Score = 125 bits (314), Expect = 1e-33 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = -3 Query: 275 EEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGRE 96 E+ E+ P +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKSAGR+ Sbjct: 104 EDKLKESEPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRD 163 Query: 95 AIMRENP 75 AI RENP Sbjct: 164 AIARENP 170 >ref|XP_009783307.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Nicotiana sylvestris] ref|XP_016432448.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana tabacum] Length = 180 Score = 125 bits (314), Expect = 1e-33 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = -3 Query: 275 EEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGRE 96 E+ E+ P +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKSAGR+ Sbjct: 104 EDKLKESEPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRD 163 Query: 95 AIMRENP 75 AI RENP Sbjct: 164 AIARENP 170 >gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum] Length = 147 Score = 124 bits (311), Expect = 2e-33 Identities = 53/67 (79%), Positives = 59/67 (88%) Frame = -3 Query: 275 EEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGRE 96 E+ E+ P +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDC+YDYK+AGRE Sbjct: 77 EDQLKESLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCNYDYKTAGRE 136 Query: 95 AIMRENP 75 AI RENP Sbjct: 137 AIARENP 143 >ref|XP_010106958.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Morus notabilis] gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Morus notabilis] Length = 172 Score = 125 bits (313), Expect = 2e-33 Identities = 58/76 (76%), Positives = 63/76 (82%) Frame = -3 Query: 302 ESTCDEWGSEEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCS 123 ++T D SEE + A P +R VNRCSGCRRKVGLTGFRCRCGELFCA+HRYSDRHDCS Sbjct: 90 KTTADSARSEE---DEAVPAKRVVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCS 146 Query: 122 YDYKSAGREAIMRENP 75 YDYKS GREAI RENP Sbjct: 147 YDYKSVGREAIARENP 162 >gb|ATW75720.1| stress-associated protein 1 [Solanum tuberosum] Length = 187 Score = 125 bits (314), Expect = 2e-33 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = -3 Query: 275 EEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGRE 96 E+ E+ P +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYK+AGRE Sbjct: 111 EDQLKESLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGRE 170 Query: 95 AIMRENP 75 AI RENP Sbjct: 171 AIARENP 177 >gb|ATW75722.1| stress-associated protein 1 [Solanum tuberosum] Length = 187 Score = 125 bits (314), Expect = 2e-33 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = -3 Query: 275 EEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGRE 96 E+ E+ P +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYK+AGRE Sbjct: 111 EDQLKESLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGRE 170 Query: 95 AIMRENP 75 AI RENP Sbjct: 171 AIARENP 177 >ref|XP_019158911.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Ipomoea nil] Length = 176 Score = 124 bits (312), Expect = 3e-33 Identities = 56/76 (73%), Positives = 62/76 (81%) Frame = -3 Query: 302 ESTCDEWGSEEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCS 123 E T +E EE + P +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCS Sbjct: 93 EKTVEE--EEEEEENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCS 150 Query: 122 YDYKSAGREAIMRENP 75 YDYK+AGR+AI RENP Sbjct: 151 YDYKAAGRDAIARENP 166 >ref|XP_009591907.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Nicotiana tomentosiformis] ref|XP_016460332.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana tabacum] Length = 180 Score = 124 bits (312), Expect = 3e-33 Identities = 53/67 (79%), Positives = 59/67 (88%) Frame = -3 Query: 275 EEXXPEAAQPVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKSAGRE 96 E+ E+ P +REVNRCSGCRRKVGLTGFRCRCG+LFC +HRYSDRHDCSYDYKSAGR+ Sbjct: 104 EDKMKESVPPAKREVNRCSGCRRKVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKSAGRD 163 Query: 95 AIMRENP 75 AI RENP Sbjct: 164 AIARENP 170