BLASTX nr result
ID: Rehmannia29_contig00013752
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00013752 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14387.1| putative Zn-finger protein [Handroanthus impetigi... 142 2e-40 ref|XP_011093526.1| zinc finger A20 and AN1 domain-containing st... 137 2e-38 ref|XP_012844705.1| PREDICTED: zinc finger A20 and AN1 domain-co... 132 4e-36 gb|PIN18775.1| putative Zn-finger protein [Handroanthus impetigi... 127 2e-34 gb|KZV50293.1| stress-associated protein 1 [Dorcoceras hygrometr... 125 1e-33 gb|ACM68451.1| stress-associated protein 1, partial [Solanum pen... 119 2e-32 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] >gi|... 119 2e-32 gb|OWM78363.1| hypothetical protein CDL15_Pgr016087 [Punica gran... 122 4e-32 ref|XP_011087429.1| zinc finger A20 and AN1 domain-containing st... 121 4e-32 ref|XP_012849801.1| PREDICTED: zinc finger A20 and AN1 domain-co... 121 5e-32 ref|XP_022896572.1| zinc finger A20 and AN1 domain-containing st... 120 7e-32 ref|XP_022865224.1| zinc finger A20 and AN1 domain-containing st... 119 2e-31 ref|XP_017625186.1| PREDICTED: zinc finger A20 and AN1 domain-co... 119 2e-31 ref|XP_016537825.1| PREDICTED: zinc finger A20 and AN1 domain-co... 119 3e-31 gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum] 118 3e-31 gb|ATW75720.1| stress-associated protein 1 [Solanum tuberosum] 119 4e-31 gb|ATW75722.1| stress-associated protein 1 [Solanum tuberosum] 119 4e-31 ref|XP_015062640.1| PREDICTED: zinc finger A20 and AN1 domain-co... 119 4e-31 ref|NP_001307079.1| stress-associated protein 1 [Solanum lycoper... 119 4e-31 ref|XP_016705943.1| PREDICTED: zinc finger A20 and AN1 domain-co... 119 5e-31 >gb|PIN14387.1| putative Zn-finger protein [Handroanthus impetiginosus] Length = 177 Score = 142 bits (359), Expect = 2e-40 Identities = 66/80 (82%), Positives = 66/80 (82%) Frame = -1 Query: 308 LNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR 129 LNLPETSGDLKK RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR Sbjct: 88 LNLPETSGDLKKEAAAEAEASPPARREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR 147 Query: 128 HDCSYDYKTVGREAIMRENP 69 HDCSYDYKT GREAI RENP Sbjct: 148 HDCSYDYKTAGREAIARENP 167 >ref|XP_011093526.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Sesamum indicum] Length = 177 Score = 137 bits (346), Expect = 2e-38 Identities = 64/80 (80%), Positives = 66/80 (82%) Frame = -1 Query: 308 LNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR 129 LN+ ETSGDLKK V+REVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR Sbjct: 88 LNMSETSGDLKKEASETADVAPPVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR 147 Query: 128 HDCSYDYKTVGREAIMRENP 69 HDCSYDYKT GREAI RENP Sbjct: 148 HDCSYDYKTAGREAIARENP 167 >ref|XP_012844705.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata] Length = 179 Score = 132 bits (331), Expect = 4e-36 Identities = 64/100 (64%), Positives = 67/100 (67%) Frame = -1 Query: 368 VFGEXXXXXXXXXXXXXXXSLNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGL 189 VFGE LNLP T DL+K +REVNRC+GCRRKVGL Sbjct: 70 VFGEKSFRSRSSTRSSPERRLNLPVTVLDLEKNPSAVADAAPPAKREVNRCTGCRRKVGL 129 Query: 188 TGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 TGFRCRCGELFCADHRYSDRHDCSYDYKT GREAI RENP Sbjct: 130 TGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 169 >gb|PIN18775.1| putative Zn-finger protein [Handroanthus impetiginosus] Length = 178 Score = 127 bits (320), Expect = 2e-34 Identities = 60/79 (75%), Positives = 62/79 (78%) Frame = -1 Query: 305 NLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRH 126 N ETS DLKK V+REVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRH Sbjct: 90 NPAETSRDLKKELSTAPEDAPPVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRH 149 Query: 125 DCSYDYKTVGREAIMRENP 69 DC YDYK+ GREAI RENP Sbjct: 150 DCRYDYKSAGREAIARENP 168 >gb|KZV50293.1| stress-associated protein 1 [Dorcoceras hygrometricum] Length = 175 Score = 125 bits (314), Expect = 1e-33 Identities = 62/102 (60%), Positives = 66/102 (64%) Frame = -1 Query: 374 NYVFGEXXXXXXXXXXXXXXXSLNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKV 195 N+VFGE N ET+GDLK +REVNRCSGCRRKV Sbjct: 65 NHVFGEDTIRSGACGRSSPERGSNPAETTGDLKTEASTEAALPPV-KREVNRCSGCRRKV 123 Query: 194 GLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 GLTGFRCRCGEL CADHRYSDRHDCSYDYK GREAI +ENP Sbjct: 124 GLTGFRCRCGELLCADHRYSDRHDCSYDYKAAGREAIAKENP 165 >gb|ACM68451.1| stress-associated protein 1, partial [Solanum pennellii] Length = 87 Score = 119 bits (299), Expect = 2e-32 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 22 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 77 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] gb|PHT59116.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum baccatum] gb|PHU30166.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum chinense] Length = 88 Score = 119 bits (299), Expect = 2e-32 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 23 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 78 >gb|OWM78363.1| hypothetical protein CDL15_Pgr016087 [Punica granatum] gb|PKI31656.1| hypothetical protein CRG98_047940 [Punica granatum] Length = 181 Score = 122 bits (305), Expect = 4e-32 Identities = 53/56 (94%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK GREAI RENP Sbjct: 116 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKAAGREAIARENP 171 >ref|XP_011087429.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Sesamum indicum] Length = 170 Score = 121 bits (304), Expect = 4e-32 Identities = 57/76 (75%), Positives = 61/76 (80%) Frame = -1 Query: 296 ETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCS 117 +TSGDLK V+R+VNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCS Sbjct: 87 DTSGDLK--IEAAEVEAPPVKRQVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCS 144 Query: 116 YDYKTVGREAIMRENP 69 YDYK GR+AI RENP Sbjct: 145 YDYKAAGRQAIARENP 160 >ref|XP_012849801.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata] Length = 178 Score = 121 bits (304), Expect = 5e-32 Identities = 57/77 (74%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = -1 Query: 296 ETSGDLKKXXXXXXXXXXXV-RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDC 120 ETS DL+K +REVNRCSGCRRKVGLTGFRCRCG+LFCADHRYSDRHDC Sbjct: 92 ETSRDLRKLDDSPAAEAALPLKREVNRCSGCRRKVGLTGFRCRCGDLFCADHRYSDRHDC 151 Query: 119 SYDYKTVGREAIMRENP 69 SYDYK+ GREAI RENP Sbjct: 152 SYDYKSAGREAIERENP 168 >ref|XP_022896572.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Olea europaea var. sylvestris] Length = 165 Score = 120 bits (302), Expect = 7e-32 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK GREAI RENP Sbjct: 100 KREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKAAGREAISRENP 155 >ref|XP_022865224.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Olea europaea var. sylvestris] Length = 165 Score = 119 bits (299), Expect = 2e-31 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFCADHRY+DRHDCSYDYK GREAI RENP Sbjct: 100 KREVNRCSGCRRKVGLTGFRCRCGELFCADHRYTDRHDCSYDYKAAGREAITRENP 155 >ref|XP_017625186.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Gossypium arboreum] Length = 173 Score = 119 bits (299), Expect = 2e-31 Identities = 53/80 (66%), Positives = 62/80 (77%) Frame = -1 Query: 308 LNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR 129 L+ P+T+ ++ ++ VNRCSGCR++VGLTGFRCRCGELFCADHRYSDR Sbjct: 84 LSPPKTTAFVRSSGSRNDPDPGTEKKVVNRCSGCRKRVGLTGFRCRCGELFCADHRYSDR 143 Query: 128 HDCSYDYKTVGREAIMRENP 69 HDCSYDYKTVGREAI RENP Sbjct: 144 HDCSYDYKTVGREAIARENP 163 >ref|XP_016537825.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Capsicum annuum] Length = 184 Score = 119 bits (299), Expect = 3e-31 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 119 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 174 >gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum] Length = 147 Score = 118 bits (296), Expect = 3e-31 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDC+YDYKT GREAI RENP Sbjct: 88 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENP 143 >gb|ATW75720.1| stress-associated protein 1 [Solanum tuberosum] Length = 187 Score = 119 bits (299), Expect = 4e-31 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 122 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 177 >gb|ATW75722.1| stress-associated protein 1 [Solanum tuberosum] Length = 187 Score = 119 bits (299), Expect = 4e-31 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 122 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 177 >ref|XP_015062640.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Solanum pennellii] Length = 188 Score = 119 bits (299), Expect = 4e-31 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 123 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 178 >ref|NP_001307079.1| stress-associated protein 1 [Solanum lycopersicum] gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum] Length = 188 Score = 119 bits (299), Expect = 4e-31 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 236 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 69 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 123 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 178 >ref|XP_016705943.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Gossypium hirsutum] gb|PPD74258.1| hypothetical protein GOBAR_DD28805 [Gossypium barbadense] Length = 173 Score = 119 bits (297), Expect = 5e-31 Identities = 53/80 (66%), Positives = 62/80 (77%) Frame = -1 Query: 308 LNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDR 129 L+ P+T+ ++ ++ VNRCSGCR++VGLTGFRCRCGELFCADHRYSDR Sbjct: 84 LSPPKTTTFVRSSGSRNDPEPGTEKKVVNRCSGCRKRVGLTGFRCRCGELFCADHRYSDR 143 Query: 128 HDCSYDYKTVGREAIMRENP 69 HDCSYDYKTVGREAI RENP Sbjct: 144 HDCSYDYKTVGREAIARENP 163