BLASTX nr result
ID: Rehmannia29_contig00013739
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00013739 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07329.1| SAP family cell cycle dependent phosphatase-assoc... 54 2e-07 >gb|PIN07329.1| SAP family cell cycle dependent phosphatase-associated protein [Handroanthus impetiginosus] Length = 790 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 9/64 (14%) Frame = +2 Query: 23 SNSTNTTDAAEEPSLPNGELQVEL-GEPNIVGTDKTIA--------PDDCETDRGGPLHR 175 SNS NT +A + PSLPNGELQV++ G+P+IVG DK +A D+C T+ G Sbjct: 687 SNSANTANATQPPSLPNGELQVQVEGQPDIVGADKNVATPTSAVGPADNCMTEGGASPDS 746 Query: 176 KRLS 187 K ++ Sbjct: 747 KEIN 750 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 163 SPAPKEIEPGTNPSQSTEAAEKGTEAER 246 SP KEI G+NP Q+ EA E E+ Sbjct: 743 SPDSKEINSGSNPLQTKEAGEGNCSIEK 770