BLASTX nr result
ID: Rehmannia29_contig00013326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00013326 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN13079.1| hypothetical protein CDL12_14305 [Handroanthus im... 60 2e-07 >gb|PIN13079.1| hypothetical protein CDL12_14305 [Handroanthus impetiginosus] Length = 735 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -1 Query: 436 IHGLMEARGFVSSQQLKMAMMASQAIGKSSKRNKFSLIRDK 314 IHGLMEARGFV S++LK+A++A + +GKS K NK SL+RDK Sbjct: 695 IHGLMEARGFVLSERLKVALLARETVGKSDKSNKSSLVRDK 735