BLASTX nr result
ID: Rehmannia29_contig00013231
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00013231 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009382448.1| hypothetical protein AEK19_MT2018 (mitochond... 115 6e-31 gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] 86 5e-19 gb|PLY95751.1| hypothetical protein LSAT_5X123920 [Lactuca sativa] 85 9e-19 gb|KVH87930.1| hypothetical protein Ccrd_024755 [Cynara carduncu... 79 5e-15 gb|PHT42750.1| NADH-ubiquinone oxidoreductase chain 1 [Capsicum ... 73 3e-13 dbj|GAY34792.1| hypothetical protein CUMW_277200 [Citrus unshiu] 60 4e-13 emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 67 5e-11 gb|KVH87929.1| Domain X, partial [Cynara cardunculus var. scolymus] 66 2e-09 gb|PHU02099.1| NADH-ubiquinone oxidoreductase chain 1 [Capsicum ... 59 1e-07 >ref|YP_009382448.1| hypothetical protein AEK19_MT2018 (mitochondrion) [Utricularia reniformis] gb|ART32178.1| hypothetical protein AEK19_MT2018 (mitochondrion) [Utricularia reniformis] Length = 77 Score = 115 bits (289), Expect = 6e-31 Identities = 60/71 (84%), Positives = 60/71 (84%) Frame = +2 Query: 35 MQLRGPLVGPDRWWYHTLLKETVRDTLASYGSVPESGPYLFFDQRSSNQPETHSAVPGCV 214 MQLR PLVGPDRW LLKETVRDTLASYGSVPESGP LFFDQRSSNQPETHS V Sbjct: 1 MQLRRPLVGPDRWEQSNLLKETVRDTLASYGSVPESGPPLFFDQRSSNQPETHS-----V 55 Query: 215 VPRSPLLNVGF 247 VPRSPLLNVGF Sbjct: 56 VPRSPLLNVGF 66 >gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 85.5 bits (210), Expect = 5e-19 Identities = 41/46 (89%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = +2 Query: 35 MQLRGPLVGPDRWWYHTLLKETVRDTLASYGSVPESGPYLF-FDQR 169 MQLRGPLVGPDRWWYHTLLK TVRDTLASYGS PESGP F FDQR Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQR 46 >gb|PLY95751.1| hypothetical protein LSAT_5X123920 [Lactuca sativa] Length = 87 Score = 85.1 bits (209), Expect = 9e-19 Identities = 40/49 (81%), Positives = 41/49 (83%) Frame = +2 Query: 35 MQLRGPLVGPDRWWYHTLLKETVRDTLASYGSVPESGPYLFFDQRSSNQ 181 MQLRGPLVGPDRWWYHTLLK TVR+TLASYGSVPESGP SSNQ Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRETLASYGSVPESGPPFPLTNGSSNQ 49 >gb|KVH87930.1| hypothetical protein Ccrd_024755 [Cynara cardunculus var. scolymus] Length = 240 Score = 79.3 bits (194), Expect = 5e-15 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = +2 Query: 35 MQLRGPLVGPDRWWYHTLLKETVRDTLASYGSVPESGPYLFFDQRSSNQ 181 MQLRGPLVGPDRWWYHTLLK TV +TLASY S+P+SGP SSNQ Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVHETLASYDSIPKSGPPFSLTNGSSNQ 49 >gb|PHT42750.1| NADH-ubiquinone oxidoreductase chain 1 [Capsicum baccatum] Length = 174 Score = 73.2 bits (178), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 103 YGFFEKGVIPPPIRPDERSTELHPYSPGLCTSL 5 YGFFEKGVIPPPIRPD++STELHPYSPGLCTSL Sbjct: 2 YGFFEKGVIPPPIRPDDQSTELHPYSPGLCTSL 34 >dbj|GAY34792.1| hypothetical protein CUMW_277200 [Citrus unshiu] Length = 266 Score = 59.7 bits (143), Expect(2) = 4e-13 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 85 GVIPPPIRPDERSTELHPYSPGLCTSL 5 GVIPPPIRPDERSTELHPYSPG CTSL Sbjct: 41 GVIPPPIRPDERSTELHPYSPGPCTSL 67 Score = 42.4 bits (98), Expect(2) = 4e-13 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 167 VGQRKGKVLIPGRSRMTRECH 105 VGQRKG+VLIPGRSRMTRE H Sbjct: 20 VGQRKGEVLIPGRSRMTRESH 40 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 66.6 bits (161), Expect = 5e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 69 GGGITPFSKKPYVTLSRHTAPSRNQDLTFSLTNG 170 GGGITPFSK+PYVTLSRHTAPSRN+DL F LTNG Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNG 53 >gb|KVH87929.1| Domain X, partial [Cynara cardunculus var. scolymus] Length = 662 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 94 FEKGVIPPPIRPDERSTELHPYSPGLCTSL 5 FEKGVIPPPIRPDERSTELHPYSPG CTSL Sbjct: 545 FEKGVIPPPIRPDERSTELHPYSPGPCTSL 574 >gb|PHU02099.1| NADH-ubiquinone oxidoreductase chain 1 [Capsicum chinense] Length = 206 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 82 VIPPPIRPDERSTELHPYSPGLCTSL 5 +IPPPIRPDERSTELHPYSPGLCTSL Sbjct: 1 MIPPPIRPDERSTELHPYSPGLCTSL 26