BLASTX nr result
ID: Rehmannia29_contig00013124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00013124 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08389.1| hypothetical protein CDL12_19041 [Handroanthus im... 80 4e-15 gb|PIN05739.1| hypothetical protein CDL12_21724 [Handroanthus im... 80 4e-15 ref|XP_009590203.1| PREDICTED: GATA transcription factor 21-like... 76 2e-14 ref|XP_011078200.2| LOW QUALITY PROTEIN: putative GATA transcrip... 77 2e-13 ref|XP_012848547.1| PREDICTED: putative GATA transcription facto... 75 2e-13 ref|XP_022867805.1| GATA transcription factor 21-like [Olea euro... 76 3e-13 gb|KZV29646.1| GATA transcription factor 22-like [Dorcoceras hyg... 73 3e-13 ref|XP_016488017.1| PREDICTED: putative GATA transcription facto... 76 3e-13 ref|XP_016540407.1| PREDICTED: GATA transcription factor 21-like... 76 3e-13 ref|XP_011093726.1| putative GATA transcription factor 22 [Sesam... 75 5e-13 ref|XP_019234671.1| PREDICTED: putative GATA transcription facto... 75 6e-13 gb|PHU08141.1| GATA transcription factor 16 [Capsicum chinense] 75 7e-13 gb|PHT73537.1| GATA transcription factor 16 [Capsicum annuum] 75 7e-13 gb|PIN16831.1| hypothetical protein CDL12_10516 [Handroanthus im... 75 7e-13 gb|EYU27295.1| hypothetical protein MIMGU_mgv1a020800mg [Erythra... 75 8e-13 gb|PHT52118.1| hypothetical protein CQW23_06580 [Capsicum baccatum] 75 8e-13 ref|XP_015059328.1| PREDICTED: putative GATA transcription facto... 74 1e-12 ref|XP_006353530.1| PREDICTED: putative GATA transcription facto... 74 2e-12 ref|XP_004243958.1| PREDICTED: GATA transcription factor 21 [Sol... 73 3e-12 ref|XP_015080599.1| PREDICTED: putative GATA transcription facto... 73 3e-12 >gb|PIN08389.1| hypothetical protein CDL12_19041 [Handroanthus impetiginosus] Length = 277 Score = 80.5 bits (197), Expect = 4e-15 Identities = 43/57 (75%), Positives = 47/57 (82%) Frame = -1 Query: 312 MAGTTESSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 MA SSSDS ++KK+ EDFLINLSNNL+ RVFPQDEKDAAILLMALSSGLVH Sbjct: 222 MASAAGSSSDS--EQKKLGFEDFLINLSNNLSFHRVFPQDEKDAAILLMALSSGLVH 276 >gb|PIN05739.1| hypothetical protein CDL12_21724 [Handroanthus impetiginosus] Length = 277 Score = 80.5 bits (197), Expect = 4e-15 Identities = 43/57 (75%), Positives = 47/57 (82%) Frame = -1 Query: 312 MAGTTESSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 MA SSSDS ++KK+ EDFLINLSNNL+ RVFPQDEKDAAILLMALSSGLVH Sbjct: 222 MASAAGSSSDS--EQKKLGFEDFLINLSNNLSFHRVFPQDEKDAAILLMALSSGLVH 276 >ref|XP_009590203.1| PREDICTED: GATA transcription factor 21-like, partial [Nicotiana tomentosiformis] ref|XP_016491814.1| PREDICTED: GATA transcription factor 21-like, partial [Nicotiana tabacum] Length = 135 Score = 75.9 bits (185), Expect = 2e-14 Identities = 39/56 (69%), Positives = 43/56 (76%) Frame = -1 Query: 309 AGTTESSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 A SSS + +KKI EDF +NLSNNLA RVFPQDEK+AAILLMALSSGLVH Sbjct: 79 AAVGSSSSTINNAQKKICFEDFFVNLSNNLALHRVFPQDEKEAAILLMALSSGLVH 134 >ref|XP_011078200.2| LOW QUALITY PROTEIN: putative GATA transcription factor 22 [Sesamum indicum] Length = 317 Score = 76.6 bits (187), Expect = 2e-13 Identities = 41/54 (75%), Positives = 45/54 (83%) Frame = -1 Query: 303 TTESSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 T SSS S+GQKK + EDFLINLS NLA RVFP+DEKDAAILLMALSSGL+H Sbjct: 264 TAGSSSPSNGQKK-LGFEDFLINLSKNLAFHRVFPEDEKDAAILLMALSSGLLH 316 >ref|XP_012848547.1| PREDICTED: putative GATA transcription factor 22 [Erythranthe guttata] Length = 206 Score = 74.7 bits (182), Expect = 2e-13 Identities = 39/52 (75%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -1 Query: 294 SSSDSSGQ-KKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 SS+DS+ KKK+ E+FLINLSNNL+ RVFP DEKDAAILLMALSSGLVH Sbjct: 154 SSADSTNNGKKKLGFEEFLINLSNNLSIHRVFPDDEKDAAILLMALSSGLVH 205 >ref|XP_022867805.1| GATA transcription factor 21-like [Olea europaea var. sylvestris] Length = 303 Score = 75.9 bits (185), Expect = 3e-13 Identities = 39/50 (78%), Positives = 41/50 (82%) Frame = -1 Query: 291 SSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 +S S KK+ LEDFLINLS NLA RVFPQDEKDAAILLMALSSGLVH Sbjct: 253 TSGPSNDTKKLGLEDFLINLSKNLALNRVFPQDEKDAAILLMALSSGLVH 302 >gb|KZV29646.1| GATA transcription factor 22-like [Dorcoceras hygrometricum] Length = 157 Score = 73.2 bits (178), Expect = 3e-13 Identities = 42/59 (71%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = -1 Query: 312 MAGTTESSSDSSGQ-KKKISLEDFLINLSNNLASQ-RVFPQDEKDAAILLMALSSGLVH 142 MA T +S S+G +K+ LEDFLINLS NLA + RVFPQDEKDAAILLMALSSGLVH Sbjct: 98 MAATGAGASSSNGDITQKLDLEDFLINLSKNLAFRFRVFPQDEKDAAILLMALSSGLVH 156 Score = 56.6 bits (135), Expect = 6e-07 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 2/50 (4%) Frame = -1 Query: 312 MAGTTESSSDSSGQ-KKKISLEDFLINLSNNLASQ-RVFPQDEKDAAILL 169 MA T +S S+G +K+ LEDFLINLS NLA + RVFPQDEKDAAILL Sbjct: 41 MAATGAGASSSNGDITQKLDLEDFLINLSKNLAFRFRVFPQDEKDAAILL 90 >ref|XP_016488017.1| PREDICTED: putative GATA transcription factor 22 [Nicotiana tabacum] Length = 313 Score = 75.9 bits (185), Expect = 3e-13 Identities = 39/56 (69%), Positives = 43/56 (76%) Frame = -1 Query: 309 AGTTESSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 A SSS + +KKI EDF +NLSNNLA RVFPQDEK+AAILLMALSSGLVH Sbjct: 257 AAVGSSSSTINNAQKKICFEDFFVNLSNNLALHRVFPQDEKEAAILLMALSSGLVH 312 >ref|XP_016540407.1| PREDICTED: GATA transcription factor 21-like [Capsicum annuum] Length = 323 Score = 75.9 bits (185), Expect = 3e-13 Identities = 39/63 (61%), Positives = 49/63 (77%), Gaps = 6/63 (9%) Frame = -1 Query: 312 MAGTTESSS------DSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSG 151 + G++ SSS +++ QK+K+ EDF +NLSNNLA RVFPQDEK+AAILLMALSSG Sbjct: 260 LVGSSSSSSSYNNNNNNTNQKQKLCFEDFFVNLSNNLAIHRVFPQDEKEAAILLMALSSG 319 Query: 150 LVH 142 LVH Sbjct: 320 LVH 322 >ref|XP_011093726.1| putative GATA transcription factor 22 [Sesamum indicum] Length = 308 Score = 75.1 bits (183), Expect = 5e-13 Identities = 39/50 (78%), Positives = 41/50 (82%) Frame = -1 Query: 291 SSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 SS SS K LE+FLINLSNNLA RVFP+DEKDAAILLMALSSGLVH Sbjct: 258 SSSSSSSSKASRLEEFLINLSNNLAVHRVFPEDEKDAAILLMALSSGLVH 307 >ref|XP_019234671.1| PREDICTED: putative GATA transcription factor 22 [Nicotiana attenuata] gb|OIT26588.1| putative gata transcription factor 22 [Nicotiana attenuata] Length = 317 Score = 75.1 bits (183), Expect = 6e-13 Identities = 38/56 (67%), Positives = 43/56 (76%) Frame = -1 Query: 309 AGTTESSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 A SSS + +KK+ EDF +NLSNNLA RVFPQDEK+AAILLMALSSGLVH Sbjct: 261 AAVGSSSSTINNAQKKLCFEDFFVNLSNNLALHRVFPQDEKEAAILLMALSSGLVH 316 >gb|PHU08141.1| GATA transcription factor 16 [Capsicum chinense] Length = 330 Score = 75.1 bits (183), Expect = 7e-13 Identities = 35/51 (68%), Positives = 45/51 (88%) Frame = -1 Query: 294 SSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 ++++++ QK+K+ EDF +NLSNNLA RVFPQDEK+AAILLMALSSGLVH Sbjct: 279 NNNNNTNQKQKLCFEDFFVNLSNNLAIHRVFPQDEKEAAILLMALSSGLVH 329 >gb|PHT73537.1| GATA transcription factor 16 [Capsicum annuum] Length = 333 Score = 75.1 bits (183), Expect = 7e-13 Identities = 35/51 (68%), Positives = 45/51 (88%) Frame = -1 Query: 294 SSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 ++++++ QK+K+ EDF +NLSNNLA RVFPQDEK+AAILLMALSSGLVH Sbjct: 282 NNNNNTNQKQKLCFEDFFVNLSNNLAIHRVFPQDEKEAAILLMALSSGLVH 332 >gb|PIN16831.1| hypothetical protein CDL12_10516 [Handroanthus impetiginosus] Length = 306 Score = 74.7 bits (182), Expect = 7e-13 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = -1 Query: 312 MAGTTESSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 ++ +T S SS +KKI EDF INLS NL+ RVFP+DEKDAAILLMALSSGL+H Sbjct: 249 ISASTSSGGSSSYGQKKIGFEDFFINLSKNLSFHRVFPEDEKDAAILLMALSSGLIH 305 >gb|EYU27295.1| hypothetical protein MIMGU_mgv1a020800mg [Erythranthe guttata] Length = 315 Score = 74.7 bits (182), Expect = 8e-13 Identities = 39/52 (75%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -1 Query: 294 SSSDSSGQ-KKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 SS+DS+ KKK+ E+FLINLSNNL+ RVFP DEKDAAILLMALSSGLVH Sbjct: 263 SSADSTNNGKKKLGFEEFLINLSNNLSIHRVFPDDEKDAAILLMALSSGLVH 314 >gb|PHT52118.1| hypothetical protein CQW23_06580 [Capsicum baccatum] Length = 540 Score = 75.5 bits (184), Expect = 8e-13 Identities = 39/64 (60%), Positives = 49/64 (76%), Gaps = 7/64 (10%) Frame = -1 Query: 312 MAGTTESSS-------DSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSS 154 + G++ SSS +++ QK+K+ EDF +NLSNNLA RVFPQDEK+AAILLMALSS Sbjct: 255 LVGSSSSSSSYNNNNNNNTNQKQKLCFEDFFVNLSNNLAIHRVFPQDEKEAAILLMALSS 314 Query: 153 GLVH 142 GLVH Sbjct: 315 GLVH 318 >ref|XP_015059328.1| PREDICTED: putative GATA transcription factor 22 [Solanum pennellii] Length = 327 Score = 74.3 bits (181), Expect = 1e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 273 QKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 QKKKI EDF +NLSNNLA RVFPQDEK+AAILLMALSSGLVH Sbjct: 283 QKKKICFEDFFMNLSNNLAIHRVFPQDEKEAAILLMALSSGLVH 326 >ref|XP_006353530.1| PREDICTED: putative GATA transcription factor 22 [Solanum tuberosum] Length = 323 Score = 73.6 bits (179), Expect = 2e-12 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 5/60 (8%) Frame = -1 Query: 306 GTTESSSDSSG-----QKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 G++ SSS + QKK + EDF +NLSNNLA RVFPQDEK+AAILLMALSSGLVH Sbjct: 263 GSSSSSSSYNNNNDVQQKKNLCFEDFFVNLSNNLAIHRVFPQDEKEAAILLMALSSGLVH 322 >ref|XP_004243958.1| PREDICTED: GATA transcription factor 21 [Solanum lycopersicum] Length = 266 Score = 72.8 bits (177), Expect = 3e-12 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = -1 Query: 294 SSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 SSS ++ KK+ EDFLINLSN LA Q++FPQDE +AAILLMALSSGLVH Sbjct: 215 SSSSTNNAPKKLGFEDFLINLSNKLAFQQIFPQDEMEAAILLMALSSGLVH 265 >ref|XP_015080599.1| PREDICTED: putative GATA transcription factor 22 [Solanum pennellii] Length = 267 Score = 72.8 bits (177), Expect = 3e-12 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = -1 Query: 294 SSSDSSGQKKKISLEDFLINLSNNLASQRVFPQDEKDAAILLMALSSGLVH 142 SSS ++ KK+ EDFLINLSN LA Q++FPQDE +AAILLMALSSGLVH Sbjct: 216 SSSSTNNAPKKLGFEDFLINLSNKLAFQQIFPQDEMEAAILLMALSSGLVH 266